Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3IVQ5

Protein Details
Accession A0A1E3IVQ5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKNPWRLSPTRKANQRKRLKNVDEVHydrophilic
81-100PGYRKSQHKVPKWTRTTLREHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFKPSSIVSGGLLWKNPWRLSPTRKANQRKRLKNVDEVITMIADSGISTRSLTKALALPTEAEMVPRDKYTTFSKHDPGYRKSQHKVPKWTRTTLRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.19
4 0.22
5 0.27
6 0.26
7 0.26
8 0.29
9 0.34
10 0.41
11 0.5
12 0.56
13 0.6
14 0.69
15 0.77
16 0.81
17 0.84
18 0.87
19 0.86
20 0.85
21 0.87
22 0.81
23 0.79
24 0.73
25 0.66
26 0.56
27 0.47
28 0.39
29 0.28
30 0.23
31 0.14
32 0.09
33 0.05
34 0.04
35 0.03
36 0.03
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.1
45 0.1
46 0.11
47 0.11
48 0.11
49 0.11
50 0.13
51 0.11
52 0.09
53 0.1
54 0.11
55 0.11
56 0.11
57 0.12
58 0.1
59 0.14
60 0.19
61 0.25
62 0.28
63 0.32
64 0.37
65 0.4
66 0.47
67 0.51
68 0.49
69 0.53
70 0.57
71 0.6
72 0.61
73 0.64
74 0.67
75 0.69
76 0.76
77 0.76
78 0.78
79 0.76
80 0.8
81 0.8
82 0.78
83 0.79
84 0.77
85 0.78