Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3INE0

Protein Details
Accession A0A1E3INE0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
105-126EFDMAKEKKKLKNLNRENIKAAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSTSSAARALYRRPTPFCLSTASFSSSPFVLAPKSKAGKKSKVVSSCPSGTTLTGLSILKDKPDPVALPDDQYPSWLWRILEDTGKEHKTEENAVKLSAEGNEEFDMAKEKKKLKNLNRENIKAANYLKSTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.53
4 0.53
5 0.49
6 0.46
7 0.41
8 0.39
9 0.37
10 0.36
11 0.29
12 0.27
13 0.27
14 0.21
15 0.19
16 0.16
17 0.14
18 0.12
19 0.14
20 0.16
21 0.22
22 0.27
23 0.29
24 0.38
25 0.44
26 0.49
27 0.54
28 0.6
29 0.6
30 0.62
31 0.63
32 0.59
33 0.57
34 0.51
35 0.44
36 0.38
37 0.31
38 0.24
39 0.21
40 0.17
41 0.11
42 0.11
43 0.1
44 0.09
45 0.11
46 0.11
47 0.11
48 0.11
49 0.11
50 0.1
51 0.11
52 0.11
53 0.1
54 0.14
55 0.13
56 0.14
57 0.15
58 0.16
59 0.15
60 0.16
61 0.15
62 0.12
63 0.13
64 0.13
65 0.12
66 0.11
67 0.14
68 0.14
69 0.18
70 0.17
71 0.2
72 0.24
73 0.25
74 0.25
75 0.23
76 0.23
77 0.21
78 0.26
79 0.26
80 0.26
81 0.26
82 0.26
83 0.25
84 0.24
85 0.22
86 0.17
87 0.15
88 0.1
89 0.11
90 0.12
91 0.12
92 0.12
93 0.11
94 0.17
95 0.15
96 0.2
97 0.24
98 0.31
99 0.37
100 0.47
101 0.57
102 0.6
103 0.71
104 0.76
105 0.81
106 0.84
107 0.82
108 0.78
109 0.73
110 0.65
111 0.6
112 0.52
113 0.48