Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3IJ27

Protein Details
Accession A0A1E3IJ27    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
201-220SKSLLLKKKKAKAGKAADKGHydrophilic
NLS Segment(s)
PositionSequence
206-234LKKKKAKAGKAADKGNGKAEVKETAKAEK
Subcellular Location(s) mito 17, mito_nucl 11.833, cyto_mito 10.333, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024974  Sde2_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF13019  Sde2_N_Ubi  
Amino Acid Sequences MSQKVFLSLPAPLVTIQLNLPSSTLLSSIPIPFAFSSYLRTTSSGPLSPDAQLSSLIHKDVPSHPITLFVTPRLRGGKGGFGSQLRAAGGRMSSGKSTNMDSCRDLSGRRLGTIKEAKRQAELLESESSLRAQAIAADKAKLETLERQLGINASESSGESRKRNLGKVDLGELARKKHKFDDHEFLEESREINENVRSAVSKSLLLKKKKAKAGKAADKGNGKAEVKETAKAEKDKLAMPPPPSAPAAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.14
5 0.15
6 0.14
7 0.14
8 0.13
9 0.13
10 0.12
11 0.12
12 0.08
13 0.09
14 0.11
15 0.12
16 0.13
17 0.13
18 0.14
19 0.13
20 0.15
21 0.15
22 0.14
23 0.18
24 0.19
25 0.22
26 0.21
27 0.23
28 0.23
29 0.25
30 0.29
31 0.27
32 0.26
33 0.25
34 0.26
35 0.25
36 0.24
37 0.2
38 0.16
39 0.15
40 0.14
41 0.16
42 0.16
43 0.16
44 0.15
45 0.14
46 0.17
47 0.18
48 0.22
49 0.2
50 0.2
51 0.2
52 0.23
53 0.24
54 0.24
55 0.23
56 0.22
57 0.24
58 0.23
59 0.27
60 0.26
61 0.25
62 0.24
63 0.24
64 0.26
65 0.24
66 0.25
67 0.23
68 0.21
69 0.22
70 0.2
71 0.2
72 0.13
73 0.12
74 0.11
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.1
81 0.11
82 0.12
83 0.13
84 0.15
85 0.19
86 0.2
87 0.21
88 0.21
89 0.22
90 0.22
91 0.22
92 0.2
93 0.18
94 0.22
95 0.21
96 0.21
97 0.21
98 0.19
99 0.25
100 0.33
101 0.32
102 0.33
103 0.36
104 0.35
105 0.35
106 0.35
107 0.29
108 0.24
109 0.22
110 0.18
111 0.15
112 0.14
113 0.14
114 0.13
115 0.12
116 0.09
117 0.08
118 0.05
119 0.04
120 0.06
121 0.08
122 0.11
123 0.11
124 0.11
125 0.12
126 0.12
127 0.12
128 0.1
129 0.09
130 0.1
131 0.14
132 0.17
133 0.17
134 0.17
135 0.17
136 0.17
137 0.17
138 0.15
139 0.11
140 0.08
141 0.08
142 0.08
143 0.1
144 0.13
145 0.15
146 0.15
147 0.17
148 0.24
149 0.27
150 0.31
151 0.32
152 0.33
153 0.35
154 0.35
155 0.35
156 0.32
157 0.29
158 0.3
159 0.28
160 0.28
161 0.31
162 0.31
163 0.3
164 0.34
165 0.41
166 0.43
167 0.49
168 0.54
169 0.51
170 0.54
171 0.53
172 0.47
173 0.42
174 0.36
175 0.29
176 0.2
177 0.17
178 0.13
179 0.15
180 0.17
181 0.14
182 0.15
183 0.15
184 0.15
185 0.14
186 0.17
187 0.16
188 0.17
189 0.21
190 0.3
191 0.37
192 0.41
193 0.49
194 0.55
195 0.62
196 0.68
197 0.72
198 0.71
199 0.73
200 0.79
201 0.8
202 0.79
203 0.76
204 0.74
205 0.71
206 0.65
207 0.59
208 0.55
209 0.45
210 0.39
211 0.36
212 0.37
213 0.34
214 0.36
215 0.34
216 0.34
217 0.39
218 0.41
219 0.41
220 0.39
221 0.39
222 0.38
223 0.43
224 0.43
225 0.42
226 0.41
227 0.45
228 0.42
229 0.43
230 0.4
231 0.35