Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I469

Protein Details
Accession A0A1E3I469   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
93-114FEKVREKRGMPWRKKYDPTLNMHydrophilic
512-538EVSLTGSAPRKKRKTCSQVTKKVTNGAHydrophilic
NLS Segment(s)
PositionSequence
29-47KPSPAKGKHKTAGQAKRKF
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003651  Endonuclease3_FeS-loop_motif  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
IPR044298  MIG/MutY  
IPR029119  MutY_C  
IPR015797  NUDIX_hydrolase-like_dom_sf  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0000702  F:oxidized base lesion DNA N-glycosylase activity  
GO:0000701  F:purine-specific mismatch base pair DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
PF14815  NUDIX_4  
CDD cd03431  DNA_Glycosylase_C  
cd00056  ENDO3c  
Amino Acid Sequences MPPSKRSPSIYSVSDLDTPSDYAPSPEAKPSPAKGKHKTAGQAKRKFAAGDSKKDDSIVDIEDISIHVDRKHGQDYHDVENVVSGQRNLLAWFEKVREKRGMPWRKKYDPTLNMEEKGQRAYEVSYLEVMLQQTQVATVIAYWQKWIAKWPTIADLAKADVEEVNAAWRGLGYYRRARSLLEGAKTVMSNSKYHGRLPSDPVVLEKEITGVGRYTAGAICSMAYGIKTPIVDGNIHRLLTRLLALYAPQTAPLTIKFLWAAAQKLVEQLPEKDTYKGITGDWNQALMELGSQVCKPVSAECGTCPLQKACKAYSELSEAPTKIVSTETKCQLCAPIPREPNQDRIPSVTVFPMKKEKKLSRIEEESVCVIEWQGLEQERRWLFTKRPEKGLLAGLYEPPTIPVASGSTFSEKLSASIEVIGDCIFLSRDDIEIIKASSRRVRSISHIFSHINMTYHIFHIIVNTPTYSPFSIKDNAPRPIAWLNAEEVEGANVGTGVKKVWAEIYGSWGSFEVSLTGSAPRKKRKTCSQVTKKVTNGAAEGKVVKKILMPVMPVRKRVEDEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.3
4 0.25
5 0.24
6 0.21
7 0.2
8 0.17
9 0.15
10 0.17
11 0.19
12 0.2
13 0.25
14 0.26
15 0.28
16 0.34
17 0.38
18 0.46
19 0.51
20 0.59
21 0.61
22 0.69
23 0.71
24 0.72
25 0.76
26 0.76
27 0.77
28 0.78
29 0.79
30 0.74
31 0.71
32 0.67
33 0.59
34 0.53
35 0.53
36 0.5
37 0.51
38 0.52
39 0.52
40 0.5
41 0.49
42 0.45
43 0.37
44 0.32
45 0.24
46 0.18
47 0.15
48 0.14
49 0.14
50 0.14
51 0.14
52 0.13
53 0.11
54 0.11
55 0.13
56 0.16
57 0.21
58 0.27
59 0.27
60 0.28
61 0.36
62 0.4
63 0.43
64 0.44
65 0.4
66 0.33
67 0.32
68 0.3
69 0.23
70 0.2
71 0.14
72 0.11
73 0.12
74 0.13
75 0.12
76 0.13
77 0.14
78 0.14
79 0.17
80 0.19
81 0.26
82 0.29
83 0.33
84 0.38
85 0.38
86 0.45
87 0.53
88 0.61
89 0.63
90 0.71
91 0.75
92 0.76
93 0.81
94 0.8
95 0.8
96 0.77
97 0.75
98 0.74
99 0.69
100 0.62
101 0.59
102 0.54
103 0.45
104 0.39
105 0.31
106 0.22
107 0.18
108 0.19
109 0.18
110 0.15
111 0.15
112 0.13
113 0.13
114 0.13
115 0.13
116 0.12
117 0.1
118 0.09
119 0.08
120 0.08
121 0.07
122 0.08
123 0.06
124 0.05
125 0.04
126 0.09
127 0.11
128 0.11
129 0.12
130 0.14
131 0.15
132 0.16
133 0.23
134 0.23
135 0.25
136 0.27
137 0.28
138 0.3
139 0.33
140 0.33
141 0.27
142 0.23
143 0.2
144 0.18
145 0.16
146 0.13
147 0.09
148 0.09
149 0.08
150 0.07
151 0.07
152 0.08
153 0.07
154 0.07
155 0.06
156 0.07
157 0.08
158 0.12
159 0.16
160 0.23
161 0.25
162 0.29
163 0.29
164 0.29
165 0.31
166 0.36
167 0.36
168 0.3
169 0.29
170 0.27
171 0.28
172 0.27
173 0.24
174 0.2
175 0.16
176 0.15
177 0.17
178 0.24
179 0.24
180 0.27
181 0.31
182 0.31
183 0.33
184 0.39
185 0.41
186 0.35
187 0.34
188 0.33
189 0.3
190 0.26
191 0.22
192 0.16
193 0.11
194 0.1
195 0.1
196 0.09
197 0.06
198 0.06
199 0.06
200 0.06
201 0.07
202 0.07
203 0.07
204 0.07
205 0.06
206 0.06
207 0.06
208 0.06
209 0.05
210 0.04
211 0.05
212 0.05
213 0.07
214 0.06
215 0.07
216 0.08
217 0.09
218 0.11
219 0.1
220 0.17
221 0.18
222 0.18
223 0.18
224 0.17
225 0.16
226 0.15
227 0.15
228 0.09
229 0.07
230 0.07
231 0.07
232 0.07
233 0.08
234 0.08
235 0.07
236 0.07
237 0.07
238 0.08
239 0.08
240 0.11
241 0.09
242 0.1
243 0.09
244 0.09
245 0.12
246 0.12
247 0.13
248 0.1
249 0.11
250 0.1
251 0.12
252 0.12
253 0.11
254 0.1
255 0.11
256 0.12
257 0.15
258 0.16
259 0.15
260 0.15
261 0.15
262 0.15
263 0.15
264 0.13
265 0.15
266 0.16
267 0.19
268 0.19
269 0.18
270 0.16
271 0.15
272 0.15
273 0.1
274 0.08
275 0.04
276 0.04
277 0.05
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.06
284 0.08
285 0.09
286 0.1
287 0.1
288 0.15
289 0.17
290 0.17
291 0.18
292 0.17
293 0.19
294 0.22
295 0.25
296 0.21
297 0.23
298 0.25
299 0.25
300 0.25
301 0.27
302 0.24
303 0.24
304 0.25
305 0.21
306 0.19
307 0.18
308 0.15
309 0.1
310 0.11
311 0.12
312 0.14
313 0.19
314 0.24
315 0.25
316 0.25
317 0.25
318 0.26
319 0.27
320 0.3
321 0.28
322 0.3
323 0.32
324 0.36
325 0.44
326 0.43
327 0.47
328 0.44
329 0.44
330 0.36
331 0.37
332 0.35
333 0.28
334 0.27
335 0.23
336 0.24
337 0.21
338 0.23
339 0.3
340 0.3
341 0.34
342 0.42
343 0.45
344 0.49
345 0.57
346 0.61
347 0.59
348 0.62
349 0.61
350 0.54
351 0.5
352 0.41
353 0.33
354 0.26
355 0.18
356 0.12
357 0.1
358 0.08
359 0.07
360 0.09
361 0.11
362 0.12
363 0.13
364 0.2
365 0.19
366 0.22
367 0.24
368 0.25
369 0.27
370 0.36
371 0.45
372 0.42
373 0.48
374 0.48
375 0.47
376 0.46
377 0.48
378 0.39
379 0.31
380 0.28
381 0.23
382 0.22
383 0.2
384 0.17
385 0.13
386 0.12
387 0.1
388 0.09
389 0.08
390 0.08
391 0.08
392 0.1
393 0.1
394 0.13
395 0.14
396 0.14
397 0.15
398 0.14
399 0.14
400 0.14
401 0.13
402 0.11
403 0.11
404 0.11
405 0.09
406 0.09
407 0.09
408 0.07
409 0.06
410 0.06
411 0.05
412 0.05
413 0.07
414 0.07
415 0.07
416 0.08
417 0.09
418 0.09
419 0.1
420 0.11
421 0.13
422 0.14
423 0.17
424 0.22
425 0.25
426 0.28
427 0.29
428 0.31
429 0.35
430 0.43
431 0.46
432 0.43
433 0.45
434 0.42
435 0.4
436 0.42
437 0.36
438 0.28
439 0.22
440 0.23
441 0.2
442 0.2
443 0.2
444 0.15
445 0.13
446 0.15
447 0.18
448 0.16
449 0.16
450 0.16
451 0.15
452 0.16
453 0.19
454 0.18
455 0.16
456 0.16
457 0.19
458 0.23
459 0.26
460 0.34
461 0.39
462 0.42
463 0.43
464 0.41
465 0.41
466 0.4
467 0.39
468 0.32
469 0.26
470 0.24
471 0.22
472 0.22
473 0.18
474 0.15
475 0.13
476 0.11
477 0.09
478 0.06
479 0.05
480 0.05
481 0.06
482 0.06
483 0.06
484 0.08
485 0.09
486 0.09
487 0.11
488 0.12
489 0.14
490 0.15
491 0.21
492 0.21
493 0.21
494 0.21
495 0.19
496 0.18
497 0.16
498 0.15
499 0.1
500 0.08
501 0.09
502 0.09
503 0.14
504 0.2
505 0.26
506 0.35
507 0.44
508 0.53
509 0.61
510 0.7
511 0.76
512 0.81
513 0.85
514 0.88
515 0.89
516 0.9
517 0.9
518 0.89
519 0.81
520 0.78
521 0.7
522 0.61
523 0.54
524 0.49
525 0.42
526 0.36
527 0.37
528 0.31
529 0.32
530 0.3
531 0.26
532 0.23
533 0.26
534 0.3
535 0.29
536 0.31
537 0.36
538 0.47
539 0.51
540 0.54
541 0.54
542 0.53
543 0.53