Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3IZR6

Protein Details
Accession A0A1E3IZR6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
130-175IPLTPAQKKQRDQKRREEARDRAREKMGLKTKKAKKDKRGKNNVDIBasic
NLS Segment(s)
PositionSequence
137-170KKQRDQKRREEARDRAREKMGLKTKKAKKDKRGK
Subcellular Location(s) nucl 13, mito 5, cyto 4, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQNPYQRLPQQNPLPNNSFVPSNRPRADFEDRDAYSRRLRAAHEAEFNRPPPAWWKRTLLIVGLIFMFWLSIHLGRRGMKKSQVIYASRYSDEFKYRPAASPVITEYLPDGRIRVRGASVGGVGVREEDIPLTPAQKKQRDQKRREEARDRAREKMGLKTKKAKKDKRGKNNVDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.59
3 0.55
4 0.47
5 0.42
6 0.34
7 0.38
8 0.37
9 0.42
10 0.43
11 0.44
12 0.46
13 0.48
14 0.56
15 0.5
16 0.49
17 0.49
18 0.46
19 0.47
20 0.47
21 0.43
22 0.39
23 0.38
24 0.36
25 0.29
26 0.3
27 0.35
28 0.37
29 0.38
30 0.41
31 0.41
32 0.43
33 0.45
34 0.44
35 0.37
36 0.32
37 0.28
38 0.29
39 0.35
40 0.34
41 0.34
42 0.38
43 0.37
44 0.41
45 0.41
46 0.32
47 0.28
48 0.24
49 0.2
50 0.15
51 0.13
52 0.1
53 0.08
54 0.07
55 0.03
56 0.04
57 0.04
58 0.06
59 0.08
60 0.09
61 0.12
62 0.15
63 0.2
64 0.22
65 0.24
66 0.27
67 0.3
68 0.31
69 0.33
70 0.35
71 0.32
72 0.32
73 0.33
74 0.3
75 0.26
76 0.26
77 0.23
78 0.2
79 0.23
80 0.2
81 0.18
82 0.2
83 0.21
84 0.22
85 0.22
86 0.22
87 0.18
88 0.2
89 0.19
90 0.17
91 0.16
92 0.14
93 0.12
94 0.12
95 0.12
96 0.11
97 0.1
98 0.09
99 0.12
100 0.12
101 0.12
102 0.11
103 0.11
104 0.12
105 0.12
106 0.11
107 0.09
108 0.08
109 0.08
110 0.07
111 0.06
112 0.06
113 0.05
114 0.05
115 0.05
116 0.06
117 0.07
118 0.08
119 0.11
120 0.13
121 0.19
122 0.28
123 0.36
124 0.42
125 0.5
126 0.61
127 0.69
128 0.73
129 0.79
130 0.81
131 0.84
132 0.87
133 0.87
134 0.86
135 0.86
136 0.9
137 0.82
138 0.77
139 0.7
140 0.65
141 0.57
142 0.58
143 0.57
144 0.55
145 0.59
146 0.64
147 0.69
148 0.74
149 0.83
150 0.83
151 0.84
152 0.86
153 0.9
154 0.91
155 0.93