Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3IRE0

Protein Details
Accession A0A1E3IRE0   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-127QMRAKMSAKKLQRMKKRQGRSKKINGHydrophilic
NLS Segment(s)
PositionSequence
68-127LERHMKEEKEAEHEKKVTIIKERRARKEEREREEQMRAKMSAKKLQRMKKRQGRSKKING
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTSQISSSVKETPVIVSLAATKNGRTSGKAHKLAKTALKRSYISPSLKTPFEKRMEKEKAVQSAKMLERHMKEEKEAEHEKKVTIIKERRARKEEREREEQMRAKMSAKKLQRMKKRQGRSKKING
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.12
5 0.16
6 0.16
7 0.2
8 0.19
9 0.17
10 0.19
11 0.23
12 0.23
13 0.21
14 0.23
15 0.3
16 0.4
17 0.48
18 0.49
19 0.5
20 0.52
21 0.55
22 0.59
23 0.57
24 0.53
25 0.5
26 0.51
27 0.47
28 0.46
29 0.48
30 0.46
31 0.41
32 0.37
33 0.38
34 0.37
35 0.38
36 0.39
37 0.35
38 0.36
39 0.4
40 0.42
41 0.4
42 0.47
43 0.5
44 0.49
45 0.52
46 0.49
47 0.5
48 0.46
49 0.44
50 0.34
51 0.34
52 0.34
53 0.31
54 0.28
55 0.24
56 0.24
57 0.29
58 0.33
59 0.27
60 0.26
61 0.26
62 0.26
63 0.29
64 0.34
65 0.31
66 0.31
67 0.32
68 0.31
69 0.32
70 0.33
71 0.29
72 0.33
73 0.36
74 0.41
75 0.48
76 0.57
77 0.62
78 0.65
79 0.67
80 0.68
81 0.73
82 0.74
83 0.73
84 0.73
85 0.7
86 0.69
87 0.73
88 0.68
89 0.61
90 0.56
91 0.5
92 0.46
93 0.47
94 0.48
95 0.47
96 0.48
97 0.53
98 0.57
99 0.65
100 0.72
101 0.76
102 0.81
103 0.83
104 0.87
105 0.88
106 0.91
107 0.92