Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GFN9

Protein Details
Accession C1GFN9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
47-68QTEKPLWCRIRHKLREPFSEFVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR023271  Aquaporin-like  
IPR000425  MIP  
IPR022357  MIP_CS  
Gene Ontology GO:0016020  C:membrane  
GO:0015267  F:channel activity  
KEGG pbn:PADG_06075  -  
Pfam View protein in Pfam  
PF00230  MIP  
PROSITE View protein in PROSITE  
PS00221  MIP  
CDD cd00333  MIP  
Amino Acid Sequences MILETPRQLSGPGIVDKSQDTGEIRNGSDVHGKSTLDTEAQDLTAPQTEKPLWCRIRHKLREPFSEFVGVFIIVLFGDGSVAQVILSHGQKGGYQSISWGWGLGVMLGVYCSGISGAHLNPAVTLANCIFRGFPWRKFPIYAIAQILGGFVASGVVYSNYIHAIDAFEGGVGVRTVGLDTSSAGIFCTYPAEFMNKTGQVFSEILASAMLMFCIFALLDNDNNGAGNLTPLGLFFVIFGIGACFGWETGYAINLARDFGPRLMSYFLGYGHEVPMVAPFIGCTLGGFLYDLLLYTGPSPVNTPWMGLDRLLRPTPMVSSNTETDTYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.26
4 0.27
5 0.23
6 0.21
7 0.18
8 0.19
9 0.24
10 0.26
11 0.26
12 0.27
13 0.27
14 0.26
15 0.32
16 0.29
17 0.27
18 0.27
19 0.26
20 0.23
21 0.25
22 0.24
23 0.18
24 0.18
25 0.15
26 0.14
27 0.14
28 0.13
29 0.11
30 0.12
31 0.16
32 0.16
33 0.15
34 0.19
35 0.21
36 0.24
37 0.29
38 0.37
39 0.37
40 0.44
41 0.52
42 0.58
43 0.66
44 0.72
45 0.78
46 0.78
47 0.8
48 0.83
49 0.81
50 0.72
51 0.63
52 0.6
53 0.49
54 0.4
55 0.33
56 0.22
57 0.16
58 0.13
59 0.11
60 0.05
61 0.05
62 0.04
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.03
70 0.04
71 0.05
72 0.08
73 0.09
74 0.09
75 0.09
76 0.1
77 0.11
78 0.13
79 0.16
80 0.13
81 0.13
82 0.13
83 0.14
84 0.15
85 0.14
86 0.12
87 0.08
88 0.08
89 0.08
90 0.07
91 0.06
92 0.04
93 0.04
94 0.04
95 0.04
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.06
103 0.06
104 0.08
105 0.09
106 0.09
107 0.09
108 0.1
109 0.1
110 0.07
111 0.09
112 0.07
113 0.09
114 0.09
115 0.1
116 0.09
117 0.09
118 0.18
119 0.2
120 0.25
121 0.3
122 0.33
123 0.34
124 0.35
125 0.36
126 0.35
127 0.34
128 0.31
129 0.25
130 0.21
131 0.2
132 0.19
133 0.18
134 0.1
135 0.07
136 0.04
137 0.03
138 0.02
139 0.02
140 0.02
141 0.02
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.05
154 0.04
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.05
168 0.05
169 0.05
170 0.05
171 0.05
172 0.05
173 0.05
174 0.06
175 0.05
176 0.06
177 0.07
178 0.1
179 0.1
180 0.12
181 0.16
182 0.16
183 0.16
184 0.16
185 0.15
186 0.15
187 0.15
188 0.14
189 0.12
190 0.1
191 0.1
192 0.09
193 0.09
194 0.06
195 0.06
196 0.05
197 0.03
198 0.03
199 0.02
200 0.03
201 0.03
202 0.03
203 0.05
204 0.06
205 0.06
206 0.07
207 0.08
208 0.07
209 0.08
210 0.07
211 0.06
212 0.05
213 0.05
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.04
232 0.05
233 0.05
234 0.06
235 0.05
236 0.06
237 0.07
238 0.07
239 0.08
240 0.08
241 0.09
242 0.09
243 0.1
244 0.12
245 0.12
246 0.15
247 0.14
248 0.16
249 0.17
250 0.16
251 0.16
252 0.15
253 0.14
254 0.14
255 0.14
256 0.13
257 0.12
258 0.12
259 0.11
260 0.1
261 0.11
262 0.1
263 0.09
264 0.08
265 0.07
266 0.08
267 0.08
268 0.08
269 0.06
270 0.06
271 0.06
272 0.07
273 0.07
274 0.06
275 0.07
276 0.07
277 0.07
278 0.06
279 0.06
280 0.06
281 0.06
282 0.09
283 0.09
284 0.1
285 0.12
286 0.12
287 0.17
288 0.17
289 0.17
290 0.18
291 0.21
292 0.22
293 0.21
294 0.26
295 0.25
296 0.31
297 0.32
298 0.3
299 0.27
300 0.27
301 0.3
302 0.29
303 0.28
304 0.26
305 0.3
306 0.32
307 0.34