Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3IED9

Protein Details
Accession A0A1E3IED9    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
147-173PPQRWKDSSVLKKLRKHAKNEGKVVRMHydrophilic
NLS Segment(s)
PositionSequence
158-165KKLRKHAK
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005631  SDH  
IPR036714  SDH_sf  
IPR028882  SDHAF2  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006121  P:mitochondrial electron transport, succinate to ubiquinone  
GO:0018293  P:protein-FAD linkage  
Pfam View protein in Pfam  
PF03937  Sdh5  
Amino Acid Sequences MSLARLTTAALRPATFRLLHSGPSCLGAVDPFPLPFSDPKLMQAQNRLSEDAAEWPIPQPLDRSGEDEKTLRARLVYQTRKRGTLETDLLLSTFARDALPEMNLDELKAFDKASRSDATWTRYLDEFLLLDEPDWDIFYWAVEKREPPQRWKDSSVLKKLRKHAKNEGKVVRMMPALRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.22
4 0.24
5 0.24
6 0.28
7 0.28
8 0.28
9 0.25
10 0.26
11 0.25
12 0.17
13 0.16
14 0.12
15 0.11
16 0.11
17 0.11
18 0.09
19 0.1
20 0.1
21 0.12
22 0.13
23 0.17
24 0.19
25 0.19
26 0.22
27 0.28
28 0.3
29 0.31
30 0.37
31 0.37
32 0.38
33 0.4
34 0.38
35 0.31
36 0.29
37 0.27
38 0.23
39 0.2
40 0.14
41 0.13
42 0.12
43 0.14
44 0.13
45 0.13
46 0.11
47 0.12
48 0.16
49 0.16
50 0.2
51 0.21
52 0.22
53 0.24
54 0.23
55 0.22
56 0.21
57 0.21
58 0.17
59 0.14
60 0.14
61 0.19
62 0.28
63 0.37
64 0.4
65 0.49
66 0.5
67 0.52
68 0.52
69 0.47
70 0.4
71 0.36
72 0.32
73 0.23
74 0.22
75 0.19
76 0.18
77 0.16
78 0.13
79 0.07
80 0.05
81 0.05
82 0.04
83 0.04
84 0.05
85 0.06
86 0.06
87 0.06
88 0.06
89 0.07
90 0.07
91 0.07
92 0.07
93 0.06
94 0.07
95 0.07
96 0.07
97 0.07
98 0.1
99 0.11
100 0.14
101 0.15
102 0.15
103 0.2
104 0.24
105 0.27
106 0.28
107 0.28
108 0.26
109 0.26
110 0.25
111 0.21
112 0.18
113 0.14
114 0.11
115 0.12
116 0.09
117 0.08
118 0.08
119 0.08
120 0.07
121 0.08
122 0.07
123 0.06
124 0.06
125 0.07
126 0.1
127 0.11
128 0.13
129 0.14
130 0.16
131 0.21
132 0.31
133 0.35
134 0.4
135 0.48
136 0.55
137 0.59
138 0.62
139 0.64
140 0.64
141 0.7
142 0.73
143 0.73
144 0.72
145 0.74
146 0.78
147 0.82
148 0.79
149 0.77
150 0.78
151 0.79
152 0.8
153 0.83
154 0.82
155 0.75
156 0.71
157 0.64
158 0.57
159 0.5