Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3IGG4

Protein Details
Accession A0A1E3IGG4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
112-141SSYQSRLSWKQPKPCRKKQPKGSHNITVKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 6, pero 2
Family & Domain DBs
Amino Acid Sequences MTEGNSTKTVDSRQEDAIRELLRTSPDLLHWWLNGSNNPNSLVLKSAGYEDFSRSVASSIASVYSGLVESIKSALNDTRGALTSVGNEASHICSWVRDGLSISYRGQSPGLSSYQSRLSWKQPKPCRKKQPKGSHNITVKNLSIAAVALLGLMWDPKTLQERRQDKKMFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.41
4 0.43
5 0.36
6 0.32
7 0.29
8 0.25
9 0.22
10 0.21
11 0.21
12 0.16
13 0.17
14 0.2
15 0.22
16 0.22
17 0.2
18 0.21
19 0.2
20 0.21
21 0.24
22 0.25
23 0.25
24 0.24
25 0.26
26 0.24
27 0.23
28 0.21
29 0.2
30 0.16
31 0.14
32 0.13
33 0.13
34 0.12
35 0.13
36 0.14
37 0.13
38 0.14
39 0.14
40 0.14
41 0.12
42 0.12
43 0.1
44 0.1
45 0.08
46 0.07
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.1
67 0.11
68 0.1
69 0.09
70 0.08
71 0.08
72 0.08
73 0.07
74 0.06
75 0.06
76 0.08
77 0.07
78 0.08
79 0.07
80 0.07
81 0.08
82 0.1
83 0.09
84 0.08
85 0.09
86 0.1
87 0.12
88 0.14
89 0.14
90 0.13
91 0.14
92 0.14
93 0.13
94 0.11
95 0.11
96 0.12
97 0.12
98 0.12
99 0.12
100 0.14
101 0.18
102 0.2
103 0.22
104 0.22
105 0.31
106 0.39
107 0.45
108 0.53
109 0.59
110 0.68
111 0.75
112 0.82
113 0.85
114 0.86
115 0.91
116 0.92
117 0.93
118 0.92
119 0.92
120 0.89
121 0.87
122 0.83
123 0.79
124 0.72
125 0.64
126 0.55
127 0.46
128 0.39
129 0.29
130 0.22
131 0.15
132 0.11
133 0.07
134 0.06
135 0.05
136 0.04
137 0.04
138 0.03
139 0.04
140 0.04
141 0.05
142 0.05
143 0.09
144 0.17
145 0.21
146 0.27
147 0.37
148 0.46
149 0.53
150 0.64