Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I248

Protein Details
Accession A0A1E3I248   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-112KVALRKYEKRIMRRARKVMRESENHydrophilic
NLS Segment(s)
PositionSequence
101-102RR
Subcellular Location(s) mito 8, cyto 7.5, cyto_nucl 6, nucl 3.5, extr 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036188  FAD/NAD-bd_sf  
Gene Ontology GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Amino Acid Sequences MRKLLDKEEYGNKYDPGLTWDLDLIGVIILGDAAHVMSPFAGEGVNQGYTGRRSRPRPHSSVSVHAVATKSLCLIFSLVIPADFLTLVKVALRKYEKRIMRRARKVMRESENNQEIVFGGKCRERIQEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.24
4 0.23
5 0.19
6 0.17
7 0.16
8 0.15
9 0.13
10 0.13
11 0.08
12 0.05
13 0.05
14 0.04
15 0.03
16 0.03
17 0.02
18 0.02
19 0.02
20 0.02
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.06
32 0.06
33 0.06
34 0.07
35 0.08
36 0.11
37 0.13
38 0.18
39 0.23
40 0.29
41 0.38
42 0.49
43 0.54
44 0.56
45 0.58
46 0.6
47 0.57
48 0.56
49 0.5
50 0.41
51 0.34
52 0.31
53 0.27
54 0.19
55 0.16
56 0.1
57 0.08
58 0.06
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.05
74 0.05
75 0.06
76 0.08
77 0.08
78 0.15
79 0.21
80 0.24
81 0.3
82 0.39
83 0.45
84 0.5
85 0.6
86 0.65
87 0.7
88 0.77
89 0.81
90 0.82
91 0.84
92 0.83
93 0.82
94 0.8
95 0.78
96 0.72
97 0.71
98 0.66
99 0.57
100 0.51
101 0.42
102 0.33
103 0.28
104 0.25
105 0.16
106 0.15
107 0.18
108 0.21
109 0.23
110 0.3