Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3HXZ7

Protein Details
Accession A0A1E3HXZ7    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
87-110TGPNRIKKLGKRPKNEEPKKYDNLBasic
NLS Segment(s)
PositionSequence
91-102RIKKLGKRPKNE
Subcellular Location(s) cyto_nucl 14.333, nucl 11.5, cyto 11, mito_nucl 8.498
Family & Domain DBs
Amino Acid Sequences MTAQQDLCVKAGGCSYSYFANLGKIVQVYACSVTGPKPSDYVIQPVESFECRLGQTKSVEACGAPGADFSYVYKTTKQSQGKLVMETGPNRIKKLGKRPKNEEPKKYDNLCDDPNSVLGCCRLSEQDLPVFHDRTQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.15
5 0.15
6 0.13
7 0.15
8 0.14
9 0.13
10 0.13
11 0.12
12 0.12
13 0.11
14 0.11
15 0.09
16 0.1
17 0.1
18 0.09
19 0.09
20 0.11
21 0.16
22 0.18
23 0.17
24 0.17
25 0.18
26 0.21
27 0.22
28 0.25
29 0.21
30 0.2
31 0.2
32 0.19
33 0.2
34 0.17
35 0.16
36 0.12
37 0.12
38 0.11
39 0.14
40 0.14
41 0.16
42 0.16
43 0.19
44 0.19
45 0.18
46 0.17
47 0.14
48 0.13
49 0.11
50 0.09
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.08
58 0.09
59 0.1
60 0.12
61 0.13
62 0.17
63 0.25
64 0.29
65 0.29
66 0.33
67 0.41
68 0.4
69 0.39
70 0.37
71 0.31
72 0.29
73 0.28
74 0.28
75 0.26
76 0.26
77 0.25
78 0.28
79 0.31
80 0.35
81 0.45
82 0.51
83 0.54
84 0.62
85 0.69
86 0.77
87 0.83
88 0.85
89 0.83
90 0.81
91 0.8
92 0.79
93 0.75
94 0.69
95 0.64
96 0.6
97 0.55
98 0.5
99 0.43
100 0.36
101 0.34
102 0.3
103 0.24
104 0.2
105 0.17
106 0.15
107 0.14
108 0.15
109 0.14
110 0.17
111 0.2
112 0.23
113 0.27
114 0.28
115 0.34
116 0.37
117 0.37