Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GCK9

Protein Details
Accession C1GCK9    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
100-139SSLFAKKKEQTDRRRNLTDFERFKVMRLKKQARYEVQKAHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, nucl 4, mito 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR014722  Rib_L2_dom2  
IPR002784  Ribosomal_L14e_dom  
IPR039660  Ribosomal_protein_L14  
IPR041985  RPL14_KOW  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbn:PADG_04731  -  
Pfam View protein in Pfam  
PF00467  KOW  
PF01929  Ribosomal_L14e  
CDD cd06088  KOW_RPL14  
Amino Acid Sequences MAQVDIKTSSWKLVEVGRIVLIRSGSYTGKLAVIVEIIDHKRVLVDGPAGHENKVVPRHAISLSHVSLTPFTIPKLPRSAGTGPVKKLWEKEEIDSKWASSLFAKKKEQTDRRRNLTDFERFKVMRLKKQARYEVQKAHAKIRASSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.23
3 0.24
4 0.23
5 0.23
6 0.22
7 0.22
8 0.18
9 0.14
10 0.13
11 0.14
12 0.12
13 0.13
14 0.14
15 0.13
16 0.13
17 0.13
18 0.12
19 0.09
20 0.09
21 0.07
22 0.06
23 0.1
24 0.11
25 0.12
26 0.11
27 0.11
28 0.1
29 0.11
30 0.11
31 0.08
32 0.09
33 0.09
34 0.13
35 0.18
36 0.18
37 0.18
38 0.18
39 0.17
40 0.19
41 0.22
42 0.19
43 0.16
44 0.16
45 0.18
46 0.18
47 0.19
48 0.17
49 0.18
50 0.18
51 0.17
52 0.17
53 0.15
54 0.14
55 0.14
56 0.12
57 0.08
58 0.08
59 0.12
60 0.13
61 0.15
62 0.18
63 0.18
64 0.17
65 0.22
66 0.23
67 0.27
68 0.34
69 0.35
70 0.33
71 0.36
72 0.37
73 0.33
74 0.34
75 0.29
76 0.28
77 0.26
78 0.28
79 0.33
80 0.32
81 0.34
82 0.32
83 0.29
84 0.24
85 0.22
86 0.2
87 0.13
88 0.21
89 0.25
90 0.32
91 0.37
92 0.39
93 0.47
94 0.57
95 0.64
96 0.67
97 0.71
98 0.74
99 0.77
100 0.81
101 0.74
102 0.69
103 0.67
104 0.66
105 0.6
106 0.53
107 0.53
108 0.46
109 0.48
110 0.51
111 0.5
112 0.48
113 0.55
114 0.61
115 0.62
116 0.71
117 0.78
118 0.78
119 0.81
120 0.8
121 0.78
122 0.77
123 0.77
124 0.7
125 0.68
126 0.64
127 0.57