Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GCA6

Protein Details
Accession C1GCA6    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPPRKPRCHFKDCKEPVQRIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
KEGG pbn:PADG_04628  -  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MAPPRKPRCHFKDCKEPVQRIVGDCGFCNGHFCGKHRMLESHACSGLEDCKKESHERNAERLNAERTTVIKGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.76
4 0.69
5 0.67
6 0.6
7 0.5
8 0.48
9 0.4
10 0.32
11 0.29
12 0.26
13 0.2
14 0.17
15 0.18
16 0.13
17 0.15
18 0.15
19 0.18
20 0.24
21 0.25
22 0.28
23 0.27
24 0.28
25 0.27
26 0.33
27 0.34
28 0.29
29 0.28
30 0.25
31 0.23
32 0.23
33 0.26
34 0.22
35 0.2
36 0.18
37 0.21
38 0.24
39 0.3
40 0.35
41 0.39
42 0.46
43 0.49
44 0.55
45 0.58
46 0.6
47 0.57
48 0.56
49 0.5
50 0.41
51 0.38
52 0.33
53 0.28