Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1G967

Protein Details
Accession C1G967    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-54ERQPNIRRKRWARTSRSRASIHydrophilic
NLS Segment(s)
PositionSequence
40-49RRKRWARTSR
Subcellular Location(s) nucl 16.5, mito_nucl 13, mito 8.5
Family & Domain DBs
KEGG pbn:PADG_03803  -  
Amino Acid Sequences MGHTQLVSTSPCSRFMPRSSSDLLPRGGEAANSERQPNIRRKRWARTSRSRASIAKPMNRLDWINDIEGTVGEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.39
4 0.36
5 0.38
6 0.39
7 0.39
8 0.39
9 0.38
10 0.35
11 0.29
12 0.26
13 0.23
14 0.19
15 0.15
16 0.13
17 0.13
18 0.15
19 0.16
20 0.16
21 0.15
22 0.18
23 0.23
24 0.31
25 0.36
26 0.4
27 0.49
28 0.55
29 0.64
30 0.73
31 0.78
32 0.78
33 0.8
34 0.82
35 0.8
36 0.79
37 0.75
38 0.67
39 0.62
40 0.61
41 0.58
42 0.55
43 0.51
44 0.48
45 0.46
46 0.46
47 0.42
48 0.37
49 0.36
50 0.31
51 0.29
52 0.26
53 0.24
54 0.21