Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NA23

Protein Details
Accession A0A1C7NA23    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
160-182QKNKAYFKRYQVKYRRRREGKTDBasic
NLS Segment(s)
Subcellular Location(s) nucl 12cyto 12cyto_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR005485  Rbsml_L5_euk/L18_arc  
IPR047313  SMN_C  
Gene Ontology GO:0005634  C:nucleus  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008097  F:5S rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17144  Ribosomal_L5e  
CDD cd00432  Ribosomal_L18_L5e  
cd22852  SMN_C  
Amino Acid Sequences MRLYQVMSLVQDPDQVTADLIKDLPLKPSLDASILAHEATEAKSLSNADEDQEPDASEPFPIQPLTESQLLHDQTTLIPEFIENQRVLEDNITTNEEKDTYPQSAYHEYSQPYPDPSFMQPPPIPPPSTTEEAELFSNVIMSWYYAGYYTAMYQPFVKQQKNKAYFKRYQVKYRRRREGKTDYYARKRLVVQAKNKYNSPKYRLVVRFTNKDIICQIIYAKLQGDHVLSAAYAHELPRYGVKGGLTNWASAYATGLLLARRTLTKLGLADKYEGFAEPDGTVQLIEAAEDAPRPFKAFLDVGLARTSTGARVFGAMKGASDGGIFVPHSGNRFPGFDIESKTNDDELLRNYIYGVHVAEYMEYLEEEDEERYKKQFSTFIKNGITSDMVEDMYTEAHEAIRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.16
5 0.17
6 0.14
7 0.13
8 0.15
9 0.17
10 0.18
11 0.21
12 0.22
13 0.23
14 0.22
15 0.25
16 0.24
17 0.21
18 0.22
19 0.2
20 0.2
21 0.2
22 0.18
23 0.15
24 0.14
25 0.14
26 0.13
27 0.14
28 0.11
29 0.1
30 0.12
31 0.13
32 0.14
33 0.16
34 0.15
35 0.14
36 0.17
37 0.18
38 0.18
39 0.18
40 0.17
41 0.15
42 0.15
43 0.14
44 0.11
45 0.11
46 0.1
47 0.12
48 0.11
49 0.11
50 0.11
51 0.14
52 0.17
53 0.2
54 0.19
55 0.18
56 0.26
57 0.27
58 0.25
59 0.23
60 0.2
61 0.17
62 0.21
63 0.19
64 0.12
65 0.11
66 0.1
67 0.14
68 0.16
69 0.2
70 0.16
71 0.16
72 0.17
73 0.18
74 0.19
75 0.16
76 0.15
77 0.12
78 0.14
79 0.18
80 0.17
81 0.17
82 0.17
83 0.17
84 0.15
85 0.17
86 0.18
87 0.17
88 0.18
89 0.18
90 0.22
91 0.26
92 0.28
93 0.28
94 0.3
95 0.29
96 0.31
97 0.32
98 0.3
99 0.28
100 0.26
101 0.24
102 0.22
103 0.24
104 0.27
105 0.24
106 0.3
107 0.28
108 0.3
109 0.35
110 0.36
111 0.35
112 0.29
113 0.33
114 0.31
115 0.34
116 0.31
117 0.27
118 0.24
119 0.24
120 0.24
121 0.19
122 0.14
123 0.1
124 0.1
125 0.07
126 0.06
127 0.05
128 0.04
129 0.05
130 0.05
131 0.05
132 0.05
133 0.06
134 0.06
135 0.06
136 0.07
137 0.1
138 0.1
139 0.11
140 0.11
141 0.13
142 0.2
143 0.25
144 0.29
145 0.31
146 0.39
147 0.49
148 0.57
149 0.63
150 0.64
151 0.66
152 0.68
153 0.72
154 0.74
155 0.68
156 0.7
157 0.74
158 0.76
159 0.78
160 0.82
161 0.83
162 0.81
163 0.81
164 0.8
165 0.8
166 0.77
167 0.76
168 0.75
169 0.72
170 0.73
171 0.73
172 0.64
173 0.56
174 0.49
175 0.48
176 0.48
177 0.46
178 0.47
179 0.52
180 0.58
181 0.57
182 0.59
183 0.57
184 0.55
185 0.55
186 0.52
187 0.5
188 0.45
189 0.52
190 0.53
191 0.51
192 0.52
193 0.5
194 0.48
195 0.42
196 0.49
197 0.39
198 0.37
199 0.33
200 0.27
201 0.22
202 0.18
203 0.16
204 0.11
205 0.11
206 0.11
207 0.11
208 0.09
209 0.1
210 0.1
211 0.1
212 0.07
213 0.07
214 0.07
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.05
221 0.06
222 0.06
223 0.07
224 0.09
225 0.1
226 0.1
227 0.1
228 0.11
229 0.13
230 0.13
231 0.2
232 0.18
233 0.17
234 0.17
235 0.16
236 0.16
237 0.13
238 0.13
239 0.07
240 0.06
241 0.06
242 0.07
243 0.06
244 0.07
245 0.07
246 0.07
247 0.07
248 0.09
249 0.1
250 0.09
251 0.12
252 0.13
253 0.18
254 0.2
255 0.21
256 0.22
257 0.2
258 0.21
259 0.18
260 0.17
261 0.13
262 0.1
263 0.1
264 0.08
265 0.08
266 0.08
267 0.07
268 0.07
269 0.06
270 0.06
271 0.05
272 0.05
273 0.05
274 0.05
275 0.05
276 0.06
277 0.07
278 0.07
279 0.08
280 0.1
281 0.1
282 0.1
283 0.14
284 0.14
285 0.14
286 0.2
287 0.21
288 0.2
289 0.21
290 0.2
291 0.16
292 0.16
293 0.16
294 0.1
295 0.1
296 0.1
297 0.09
298 0.11
299 0.12
300 0.12
301 0.15
302 0.13
303 0.12
304 0.13
305 0.13
306 0.1
307 0.09
308 0.09
309 0.06
310 0.08
311 0.07
312 0.07
313 0.09
314 0.1
315 0.13
316 0.13
317 0.16
318 0.17
319 0.18
320 0.18
321 0.19
322 0.22
323 0.23
324 0.27
325 0.28
326 0.28
327 0.3
328 0.31
329 0.28
330 0.25
331 0.23
332 0.22
333 0.21
334 0.25
335 0.21
336 0.19
337 0.19
338 0.2
339 0.2
340 0.18
341 0.16
342 0.11
343 0.12
344 0.12
345 0.12
346 0.1
347 0.1
348 0.09
349 0.08
350 0.08
351 0.07
352 0.07
353 0.08
354 0.1
355 0.13
356 0.15
357 0.17
358 0.18
359 0.21
360 0.23
361 0.26
362 0.32
363 0.35
364 0.44
365 0.47
366 0.52
367 0.54
368 0.53
369 0.5
370 0.45
371 0.4
372 0.3
373 0.27
374 0.2
375 0.16
376 0.15
377 0.14
378 0.12
379 0.11
380 0.1
381 0.09
382 0.08