Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N0Q4

Protein Details
Accession A0A1C7N0Q4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
325-346AYARVNTKRNLRKRAGLDRLQNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 7, cyto 1, golg 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MLPQFGFIVAQAGADSHPTTPNNNNNNSSTLGSSSTSHLTKPYPPPTTTTPNDPYYYRHTRSSPPSSLLPPPLPYMYNSSHPPSADYYPPPPPPPRYTPSIYDSPTKQQASAYRPLQPLPPPSSSNNKWHSDTNSYPHWDTLYQAPPPEVLPTKQAPSSVSLDIHSKVLQEDDYSFQRWPEESMTDLNDNKMLRRIREFKDLMTWMDTEFWEQCDDIYREKLQSLQEEIRLIQLGTHSAFKETLMDIELRREKTIEYAEFLKEYELSLSKHQFDQEMSILQEEYQNEKHSLHDLVLQAIDERKRQIREEKEIDADFNVKDLFRDAYARVNTKRNLRKRAGLDRLQNASPSRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.15
5 0.16
6 0.21
7 0.29
8 0.38
9 0.44
10 0.5
11 0.53
12 0.51
13 0.52
14 0.5
15 0.44
16 0.35
17 0.29
18 0.24
19 0.21
20 0.2
21 0.21
22 0.23
23 0.22
24 0.21
25 0.22
26 0.23
27 0.29
28 0.37
29 0.43
30 0.44
31 0.45
32 0.49
33 0.53
34 0.59
35 0.54
36 0.54
37 0.5
38 0.48
39 0.5
40 0.46
41 0.43
42 0.43
43 0.49
44 0.44
45 0.44
46 0.43
47 0.49
48 0.56
49 0.61
50 0.56
51 0.51
52 0.52
53 0.5
54 0.51
55 0.49
56 0.43
57 0.36
58 0.34
59 0.32
60 0.29
61 0.27
62 0.28
63 0.25
64 0.27
65 0.29
66 0.3
67 0.3
68 0.3
69 0.3
70 0.28
71 0.29
72 0.28
73 0.28
74 0.29
75 0.33
76 0.36
77 0.39
78 0.41
79 0.43
80 0.45
81 0.49
82 0.49
83 0.48
84 0.48
85 0.48
86 0.48
87 0.49
88 0.44
89 0.42
90 0.41
91 0.4
92 0.44
93 0.4
94 0.35
95 0.32
96 0.36
97 0.37
98 0.42
99 0.39
100 0.38
101 0.39
102 0.39
103 0.4
104 0.37
105 0.38
106 0.35
107 0.36
108 0.32
109 0.34
110 0.42
111 0.42
112 0.47
113 0.47
114 0.46
115 0.44
116 0.45
117 0.46
118 0.44
119 0.43
120 0.39
121 0.37
122 0.37
123 0.35
124 0.32
125 0.29
126 0.22
127 0.21
128 0.22
129 0.21
130 0.19
131 0.19
132 0.19
133 0.18
134 0.18
135 0.19
136 0.15
137 0.12
138 0.15
139 0.16
140 0.18
141 0.18
142 0.19
143 0.16
144 0.18
145 0.21
146 0.18
147 0.17
148 0.16
149 0.17
150 0.17
151 0.17
152 0.13
153 0.1
154 0.09
155 0.09
156 0.08
157 0.07
158 0.08
159 0.1
160 0.11
161 0.13
162 0.13
163 0.12
164 0.13
165 0.12
166 0.13
167 0.12
168 0.11
169 0.1
170 0.12
171 0.13
172 0.15
173 0.15
174 0.14
175 0.15
176 0.14
177 0.13
178 0.18
179 0.18
180 0.18
181 0.24
182 0.31
183 0.32
184 0.41
185 0.41
186 0.35
187 0.4
188 0.39
189 0.34
190 0.28
191 0.25
192 0.16
193 0.17
194 0.16
195 0.12
196 0.11
197 0.1
198 0.09
199 0.09
200 0.09
201 0.13
202 0.14
203 0.15
204 0.17
205 0.18
206 0.18
207 0.18
208 0.21
209 0.18
210 0.19
211 0.22
212 0.21
213 0.22
214 0.22
215 0.22
216 0.2
217 0.19
218 0.16
219 0.12
220 0.1
221 0.1
222 0.1
223 0.12
224 0.11
225 0.12
226 0.12
227 0.11
228 0.13
229 0.11
230 0.11
231 0.1
232 0.11
233 0.1
234 0.17
235 0.23
236 0.22
237 0.22
238 0.22
239 0.21
240 0.24
241 0.29
242 0.23
243 0.21
244 0.22
245 0.23
246 0.23
247 0.23
248 0.19
249 0.14
250 0.13
251 0.13
252 0.12
253 0.13
254 0.18
255 0.22
256 0.23
257 0.25
258 0.25
259 0.25
260 0.23
261 0.25
262 0.21
263 0.2
264 0.19
265 0.18
266 0.17
267 0.16
268 0.18
269 0.15
270 0.18
271 0.19
272 0.21
273 0.22
274 0.22
275 0.23
276 0.23
277 0.23
278 0.19
279 0.21
280 0.18
281 0.18
282 0.18
283 0.17
284 0.16
285 0.19
286 0.21
287 0.19
288 0.23
289 0.27
290 0.31
291 0.36
292 0.44
293 0.48
294 0.55
295 0.59
296 0.59
297 0.59
298 0.56
299 0.52
300 0.44
301 0.38
302 0.28
303 0.24
304 0.2
305 0.14
306 0.14
307 0.14
308 0.14
309 0.13
310 0.17
311 0.16
312 0.23
313 0.29
314 0.36
315 0.39
316 0.45
317 0.49
318 0.57
319 0.66
320 0.67
321 0.71
322 0.71
323 0.76
324 0.77
325 0.82
326 0.82
327 0.8
328 0.79
329 0.77
330 0.76
331 0.68
332 0.63