Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7NIK7

Protein Details
Accession A0A1C7NIK7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
69-91LPNPSPKKPIRNRPNKLEKHERLBasic
NLS Segment(s)
PositionSequence
74-94PKKPIRNRPNKLEKHERLRGE
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR043035  Damage-induce-interact_sf  
IPR040922  MRPL25_dom  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSTYRLFSQKVLSKVKTVKLTEADVKPQLVFNEVKGKAFWRPAQVSRRVQNDLRKACIQQGIEPSTIGLPNPSPKKPIRNRPNKLEKHERLRGEREQTIKRNLEKMPQTIQAWKEDKLKELAKQKTSMPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.58
4 0.53
5 0.5
6 0.46
7 0.49
8 0.49
9 0.46
10 0.45
11 0.39
12 0.38
13 0.33
14 0.31
15 0.27
16 0.22
17 0.2
18 0.17
19 0.24
20 0.24
21 0.24
22 0.23
23 0.24
24 0.24
25 0.29
26 0.29
27 0.27
28 0.31
29 0.37
30 0.44
31 0.51
32 0.54
33 0.54
34 0.56
35 0.54
36 0.53
37 0.54
38 0.56
39 0.5
40 0.48
41 0.44
42 0.4
43 0.39
44 0.38
45 0.31
46 0.25
47 0.27
48 0.25
49 0.23
50 0.22
51 0.2
52 0.16
53 0.15
54 0.12
55 0.07
56 0.06
57 0.12
58 0.16
59 0.17
60 0.21
61 0.23
62 0.34
63 0.42
64 0.52
65 0.57
66 0.64
67 0.71
68 0.76
69 0.85
70 0.82
71 0.81
72 0.82
73 0.78
74 0.76
75 0.77
76 0.72
77 0.68
78 0.67
79 0.65
80 0.6
81 0.58
82 0.55
83 0.56
84 0.56
85 0.58
86 0.58
87 0.54
88 0.54
89 0.5
90 0.52
91 0.49
92 0.48
93 0.45
94 0.45
95 0.44
96 0.44
97 0.45
98 0.45
99 0.42
100 0.42
101 0.45
102 0.4
103 0.42
104 0.43
105 0.45
106 0.43
107 0.5
108 0.55
109 0.52
110 0.53