Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NDL0

Protein Details
Accession A0A1C7NDL0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-45AIIIGLVRWNRKKRHRNKDEEINPIGHydrophilic
NLS Segment(s)
PositionSequence
31-34KKRH
Subcellular Location(s) nucl 9, mito 7, cyto 4, extr 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPTQIIAGLLVGLASVLLIAIIIGLVRWNRKKRHRNKDEEINPIGESVAISSELQTTPPSTLKKDCSEMQQRYALATNTQTSLCPRPLPAARILKEEQTAVADPHKLRGTFNLTPSYNDASPCSCSSHRASLNESPFRCSSTPHSHLGQLYSDKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.04
12 0.07
13 0.14
14 0.22
15 0.3
16 0.4
17 0.51
18 0.62
19 0.71
20 0.81
21 0.85
22 0.87
23 0.88
24 0.9
25 0.87
26 0.84
27 0.75
28 0.66
29 0.55
30 0.45
31 0.35
32 0.24
33 0.16
34 0.09
35 0.07
36 0.06
37 0.05
38 0.06
39 0.07
40 0.07
41 0.08
42 0.08
43 0.08
44 0.09
45 0.13
46 0.15
47 0.16
48 0.2
49 0.24
50 0.26
51 0.29
52 0.29
53 0.33
54 0.41
55 0.41
56 0.4
57 0.39
58 0.36
59 0.33
60 0.33
61 0.25
62 0.17
63 0.16
64 0.13
65 0.11
66 0.11
67 0.1
68 0.11
69 0.14
70 0.14
71 0.13
72 0.13
73 0.17
74 0.19
75 0.21
76 0.26
77 0.31
78 0.31
79 0.35
80 0.36
81 0.33
82 0.31
83 0.29
84 0.22
85 0.17
86 0.16
87 0.12
88 0.13
89 0.15
90 0.14
91 0.18
92 0.21
93 0.19
94 0.19
95 0.23
96 0.29
97 0.29
98 0.32
99 0.35
100 0.32
101 0.34
102 0.37
103 0.37
104 0.3
105 0.27
106 0.26
107 0.2
108 0.23
109 0.23
110 0.25
111 0.21
112 0.24
113 0.28
114 0.35
115 0.38
116 0.37
117 0.42
118 0.45
119 0.53
120 0.56
121 0.52
122 0.49
123 0.45
124 0.46
125 0.4
126 0.36
127 0.36
128 0.38
129 0.42
130 0.41
131 0.43
132 0.43
133 0.45
134 0.43
135 0.4
136 0.35