Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NPK9

Protein Details
Accession A0A1C7NPK9    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-35GLNAARKLRIHRRDQRWADKQYKKRALGHydrophilic
NLS Segment(s)
PositionSequence
13-22RKLRIHRRDQ
Subcellular Location(s) mito 16, cyto 7, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006032  Ribosomal_S12/S23  
IPR005680  Ribosomal_S23_euk/arc  
Gene Ontology GO:0015935  C:small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00164  Ribosom_S12_S23  
PROSITE View protein in PROSITE  
PS00055  RIBOSOMAL_S12  
CDD cd03367  Ribosomal_S23  
Amino Acid Sequences MGKGQPRGLNAARKLRIHRRDQRWADKQYKKRALGTAFRSSPFGGSSHAKGIVLEKIGVEAKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLIAGFGRKGRAIGDIPGVRFKIVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.69
4 0.71
5 0.74
6 0.74
7 0.79
8 0.84
9 0.86
10 0.84
11 0.84
12 0.84
13 0.84
14 0.83
15 0.83
16 0.83
17 0.76
18 0.72
19 0.7
20 0.65
21 0.64
22 0.61
23 0.59
24 0.52
25 0.49
26 0.45
27 0.39
28 0.34
29 0.26
30 0.2
31 0.14
32 0.15
33 0.16
34 0.16
35 0.16
36 0.15
37 0.14
38 0.15
39 0.14
40 0.12
41 0.1
42 0.08
43 0.09
44 0.1
45 0.09
46 0.09
47 0.11
48 0.11
49 0.13
50 0.14
51 0.15
52 0.2
53 0.21
54 0.25
55 0.24
56 0.28
57 0.26
58 0.32
59 0.34
60 0.35
61 0.37
62 0.42
63 0.51
64 0.51
65 0.55
66 0.51
67 0.47
68 0.41
69 0.4
70 0.33
71 0.32
72 0.28
73 0.26
74 0.28
75 0.28
76 0.28
77 0.27
78 0.24
79 0.14
80 0.17
81 0.14
82 0.11
83 0.13
84 0.12
85 0.13
86 0.12
87 0.12
88 0.08
89 0.08
90 0.08
91 0.05
92 0.05
93 0.06
94 0.07
95 0.08
96 0.09
97 0.09
98 0.1
99 0.14
100 0.16
101 0.17
102 0.25
103 0.27
104 0.29
105 0.34
106 0.33
107 0.3