Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NFZ1

Protein Details
Accession A0A1C7NFZ1    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-116ALTPFEKSKKTVRQQKKDAYFPIRKYHydrophilic
NLS Segment(s)
PositionSequence
83-100KKTRAMRRALTPFEKSKK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAIVKAHELRNKNKAELLKVLEEQKQQLANIRVQKVAGGRVQEVGEARKNVARVLTVINQTQREQLRLFYQKKRFTPLDLRVKKTRAMRRALTPFEKSKKTVRQQKKDAYFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.48
4 0.46
5 0.41
6 0.4
7 0.42
8 0.42
9 0.39
10 0.36
11 0.34
12 0.31
13 0.27
14 0.31
15 0.3
16 0.31
17 0.36
18 0.36
19 0.32
20 0.3
21 0.32
22 0.26
23 0.26
24 0.23
25 0.18
26 0.16
27 0.17
28 0.17
29 0.17
30 0.16
31 0.15
32 0.17
33 0.15
34 0.16
35 0.15
36 0.16
37 0.15
38 0.15
39 0.12
40 0.1
41 0.12
42 0.15
43 0.15
44 0.17
45 0.19
46 0.2
47 0.2
48 0.23
49 0.21
50 0.19
51 0.18
52 0.18
53 0.22
54 0.29
55 0.34
56 0.38
57 0.45
58 0.5
59 0.52
60 0.57
61 0.52
62 0.49
63 0.53
64 0.54
65 0.57
66 0.56
67 0.6
68 0.6
69 0.6
70 0.6
71 0.6
72 0.59
73 0.55
74 0.56
75 0.55
76 0.58
77 0.64
78 0.66
79 0.62
80 0.59
81 0.6
82 0.6
83 0.6
84 0.54
85 0.55
86 0.58
87 0.63
88 0.69
89 0.71
90 0.75
91 0.81
92 0.88
93 0.88
94 0.85
95 0.84
96 0.83
97 0.81
98 0.74
99 0.73
100 0.69