Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7N174

Protein Details
Accession A0A1C7N174    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
133-152KEHYGKHKDHREKYRWDHKDBasic
170-200YEDEHRKADKWDHKKHHDKNRWDHKDRHINDBasic
NLS Segment(s)
PositionSequence
139-148KHKDHREKYR
176-187RKADKWDHKKHH
Subcellular Location(s) extr 8, mito 7, nucl 6, cyto 3, E.R. 2
Family & Domain DBs
Amino Acid Sequences MVKLTATFIALSATTTAVLAGYSQDACQYSYNDNGRYVYSCEESTCSNSITWVKDHFQESMSDKGYDCRMEGDKSVSCXKPHDHSDPYSHNWSCSDKKHIWDHIKDTWEDIKDEVEDVKDRWDNRDHHDKRGYKEHYGKHKDHREKYRWDHKDHHSKNKWDSKDHHDKRGYEDEHRKADKWDHKKHHDKNRWDHKDRHINDKDHQGEYKWDHKGDHHESKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.06
5 0.06
6 0.05
7 0.05
8 0.07
9 0.07
10 0.07
11 0.1
12 0.11
13 0.12
14 0.14
15 0.16
16 0.17
17 0.24
18 0.29
19 0.29
20 0.3
21 0.29
22 0.29
23 0.29
24 0.28
25 0.23
26 0.21
27 0.2
28 0.19
29 0.2
30 0.2
31 0.21
32 0.21
33 0.19
34 0.16
35 0.18
36 0.21
37 0.21
38 0.22
39 0.22
40 0.22
41 0.25
42 0.27
43 0.25
44 0.23
45 0.24
46 0.25
47 0.27
48 0.27
49 0.23
50 0.22
51 0.23
52 0.25
53 0.21
54 0.18
55 0.16
56 0.17
57 0.18
58 0.19
59 0.2
60 0.21
61 0.24
62 0.28
63 0.27
64 0.26
65 0.28
66 0.3
67 0.34
68 0.36
69 0.37
70 0.37
71 0.42
72 0.44
73 0.46
74 0.5
75 0.41
76 0.38
77 0.35
78 0.35
79 0.32
80 0.3
81 0.33
82 0.29
83 0.33
84 0.39
85 0.45
86 0.47
87 0.46
88 0.47
89 0.45
90 0.45
91 0.4
92 0.36
93 0.32
94 0.26
95 0.23
96 0.19
97 0.14
98 0.12
99 0.13
100 0.1
101 0.08
102 0.08
103 0.08
104 0.11
105 0.13
106 0.13
107 0.16
108 0.22
109 0.24
110 0.28
111 0.4
112 0.38
113 0.43
114 0.52
115 0.53
116 0.5
117 0.58
118 0.56
119 0.52
120 0.57
121 0.57
122 0.59
123 0.63
124 0.63
125 0.63
126 0.7
127 0.72
128 0.73
129 0.77
130 0.73
131 0.75
132 0.8
133 0.81
134 0.77
135 0.74
136 0.73
137 0.73
138 0.77
139 0.75
140 0.77
141 0.74
142 0.74
143 0.78
144 0.79
145 0.73
146 0.68
147 0.67
148 0.65
149 0.68
150 0.67
151 0.67
152 0.64
153 0.61
154 0.62
155 0.66
156 0.59
157 0.57
158 0.62
159 0.59
160 0.61
161 0.63
162 0.57
163 0.51
164 0.57
165 0.58
166 0.58
167 0.62
168 0.63
169 0.71
170 0.81
171 0.87
172 0.88
173 0.88
174 0.88
175 0.89
176 0.9
177 0.91
178 0.87
179 0.85
180 0.84
181 0.85
182 0.78
183 0.78
184 0.76
185 0.7
186 0.69
187 0.71
188 0.65
189 0.59
190 0.57
191 0.48
192 0.47
193 0.48
194 0.51
195 0.46
196 0.43
197 0.41
198 0.44
199 0.52
200 0.53