Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N190

Protein Details
Accession A0A1C7N190    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-77GPSAREETKKQTKKERRKLNLIEFGLHydrophilic
NLS Segment(s)
PositionSequence
64-67KKER
Subcellular Location(s) mito 23, cyto_mito 13
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHSDTRKKKQLWTVMTHCKAVVGRAGISLAFVATASLSYRLGQLTSIFADLGPSAREETKKQTKKERRKLNLIEFGLSRTLSSTTSPVSPTAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.64
4 0.55
5 0.48
6 0.41
7 0.33
8 0.27
9 0.18
10 0.16
11 0.15
12 0.15
13 0.12
14 0.12
15 0.11
16 0.06
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.04
23 0.05
24 0.05
25 0.06
26 0.07
27 0.07
28 0.07
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.06
42 0.08
43 0.1
44 0.12
45 0.21
46 0.31
47 0.38
48 0.43
49 0.53
50 0.63
51 0.72
52 0.81
53 0.83
54 0.81
55 0.84
56 0.88
57 0.86
58 0.85
59 0.75
60 0.68
61 0.57
62 0.51
63 0.42
64 0.33
65 0.23
66 0.15
67 0.14
68 0.12
69 0.14
70 0.14
71 0.14
72 0.17
73 0.18