Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NFF6

Protein Details
Accession A0A1C7NFF6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-93LRSQGHVLTKKKRKSREQTIRAQLIRKHydrophilic
NLS Segment(s)
PositionSequence
76-82KKKRKSR
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MDTRHSQLVLISKRLESANQKIESIANELGWTRQALQQWIKDQPHVCPINKAHLVSDKEVHYRHCLLRSQGHVLTKKKRKSREQTIRAQLIRKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.29
4 0.33
5 0.38
6 0.37
7 0.37
8 0.35
9 0.36
10 0.32
11 0.3
12 0.23
13 0.14
14 0.13
15 0.13
16 0.13
17 0.12
18 0.11
19 0.09
20 0.11
21 0.12
22 0.16
23 0.19
24 0.22
25 0.25
26 0.31
27 0.3
28 0.31
29 0.31
30 0.28
31 0.33
32 0.33
33 0.3
34 0.28
35 0.28
36 0.32
37 0.33
38 0.32
39 0.25
40 0.28
41 0.3
42 0.27
43 0.29
44 0.24
45 0.26
46 0.27
47 0.27
48 0.24
49 0.26
50 0.27
51 0.28
52 0.3
53 0.3
54 0.35
55 0.37
56 0.39
57 0.38
58 0.42
59 0.45
60 0.48
61 0.55
62 0.58
63 0.64
64 0.66
65 0.73
66 0.77
67 0.8
68 0.85
69 0.86
70 0.86
71 0.88
72 0.89
73 0.89
74 0.82