Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MWF8

Protein Details
Accession A0A1C7MWF8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
337-364IPKKSKRSGTYSHKANKRRRVENGEEVLHydrophilic
NLS Segment(s)
PositionSequence
339-355KKSKRSGTYSHKANKRR
Subcellular Location(s) nucl 22.5, cyto_nucl 14.833, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000253  FHA_dom  
IPR001766  Fork_head_dom  
IPR008984  SMAD_FHA_dom_sf  
IPR018122  TF_fork_head_CS_1  
IPR030456  TF_fork_head_CS_2  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0045892  P:negative regulation of DNA-templated transcription  
GO:0045893  P:positive regulation of DNA-templated transcription  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00498  FHA  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS50006  FHA_DOMAIN  
PS00657  FORK_HEAD_1  
PS00658  FORK_HEAD_2  
PS50039  FORK_HEAD_3  
CDD cd20024  FH_FOXJ2-like  
cd22701  FHA_FKH1-like  
Amino Acid Sequences MLVAKHHPQNEMTASCFSCIEDQLNDRKRVESQSLKACPSVLFTSMASTEQTVTDSSKETVQAYAKLEGEDFCYYIRTLQVTLGRRVKKPDSVDIPLGNIKSVSRQHARLFYNFTTQRFEMMVFGKNGAFVNEQFIEKGVTVPLENKTKIQIGEVSFVFLLPRMELTATTGGTDALSNEGFGYISAPQQLEKNCKLKKPLHLTSPIGSSTEQEAEQKKYTIDRNEINTDEWVESSPEDPSIYESKDIKPPYSYASLIAQAISSSRNKRMTLNGIYTFITTNYPYYQMASNGWQNSIRHNLSLNKAFVKVPRKDSEPGKGAFWTIDESAEGQFIKTTIPKKSKRSGTYSHKANKRRRVENGEEVLDEDEDDEGDEDIDEDDNDEMEEIEDIDCEDIDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.3
4 0.25
5 0.21
6 0.21
7 0.21
8 0.2
9 0.24
10 0.33
11 0.41
12 0.46
13 0.44
14 0.44
15 0.46
16 0.48
17 0.52
18 0.5
19 0.49
20 0.54
21 0.59
22 0.59
23 0.55
24 0.5
25 0.42
26 0.38
27 0.33
28 0.24
29 0.2
30 0.18
31 0.2
32 0.2
33 0.2
34 0.16
35 0.15
36 0.14
37 0.12
38 0.13
39 0.12
40 0.12
41 0.13
42 0.15
43 0.15
44 0.16
45 0.18
46 0.18
47 0.2
48 0.22
49 0.24
50 0.25
51 0.28
52 0.26
53 0.25
54 0.25
55 0.21
56 0.23
57 0.19
58 0.17
59 0.13
60 0.14
61 0.13
62 0.14
63 0.15
64 0.12
65 0.12
66 0.16
67 0.22
68 0.25
69 0.33
70 0.4
71 0.43
72 0.45
73 0.51
74 0.51
75 0.51
76 0.51
77 0.52
78 0.51
79 0.51
80 0.53
81 0.47
82 0.45
83 0.41
84 0.37
85 0.28
86 0.21
87 0.16
88 0.18
89 0.21
90 0.25
91 0.26
92 0.31
93 0.35
94 0.42
95 0.45
96 0.43
97 0.46
98 0.41
99 0.45
100 0.44
101 0.42
102 0.39
103 0.36
104 0.35
105 0.29
106 0.27
107 0.21
108 0.2
109 0.22
110 0.17
111 0.18
112 0.16
113 0.16
114 0.16
115 0.15
116 0.14
117 0.1
118 0.14
119 0.14
120 0.15
121 0.13
122 0.14
123 0.13
124 0.11
125 0.12
126 0.08
127 0.07
128 0.07
129 0.1
130 0.14
131 0.18
132 0.18
133 0.18
134 0.2
135 0.22
136 0.22
137 0.21
138 0.21
139 0.18
140 0.21
141 0.2
142 0.19
143 0.16
144 0.16
145 0.14
146 0.11
147 0.09
148 0.05
149 0.06
150 0.05
151 0.05
152 0.05
153 0.08
154 0.09
155 0.08
156 0.09
157 0.09
158 0.08
159 0.08
160 0.08
161 0.06
162 0.06
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.06
170 0.05
171 0.05
172 0.07
173 0.07
174 0.07
175 0.1
176 0.13
177 0.18
178 0.22
179 0.3
180 0.31
181 0.34
182 0.4
183 0.43
184 0.49
185 0.53
186 0.52
187 0.5
188 0.52
189 0.52
190 0.47
191 0.44
192 0.35
193 0.27
194 0.22
195 0.17
196 0.14
197 0.13
198 0.12
199 0.13
200 0.15
201 0.17
202 0.18
203 0.18
204 0.17
205 0.2
206 0.24
207 0.25
208 0.27
209 0.28
210 0.31
211 0.34
212 0.34
213 0.32
214 0.28
215 0.25
216 0.2
217 0.16
218 0.13
219 0.1
220 0.09
221 0.08
222 0.08
223 0.07
224 0.07
225 0.07
226 0.09
227 0.11
228 0.12
229 0.15
230 0.16
231 0.18
232 0.24
233 0.25
234 0.23
235 0.22
236 0.23
237 0.23
238 0.25
239 0.23
240 0.18
241 0.19
242 0.19
243 0.18
244 0.17
245 0.13
246 0.09
247 0.1
248 0.1
249 0.13
250 0.15
251 0.21
252 0.25
253 0.26
254 0.29
255 0.34
256 0.39
257 0.4
258 0.42
259 0.38
260 0.36
261 0.35
262 0.34
263 0.28
264 0.22
265 0.18
266 0.12
267 0.12
268 0.12
269 0.13
270 0.13
271 0.14
272 0.15
273 0.14
274 0.16
275 0.18
276 0.22
277 0.21
278 0.22
279 0.24
280 0.23
281 0.26
282 0.32
283 0.29
284 0.25
285 0.28
286 0.31
287 0.34
288 0.4
289 0.38
290 0.32
291 0.33
292 0.33
293 0.36
294 0.4
295 0.4
296 0.42
297 0.44
298 0.47
299 0.51
300 0.54
301 0.56
302 0.54
303 0.49
304 0.43
305 0.39
306 0.35
307 0.3
308 0.26
309 0.2
310 0.14
311 0.13
312 0.12
313 0.12
314 0.12
315 0.13
316 0.12
317 0.09
318 0.09
319 0.09
320 0.11
321 0.14
322 0.19
323 0.26
324 0.36
325 0.44
326 0.51
327 0.61
328 0.69
329 0.71
330 0.74
331 0.75
332 0.76
333 0.77
334 0.8
335 0.8
336 0.79
337 0.81
338 0.83
339 0.84
340 0.83
341 0.82
342 0.82
343 0.82
344 0.82
345 0.82
346 0.8
347 0.72
348 0.62
349 0.55
350 0.46
351 0.37
352 0.28
353 0.18
354 0.11
355 0.08
356 0.08
357 0.07
358 0.06
359 0.06
360 0.06
361 0.06
362 0.07
363 0.07
364 0.07
365 0.07
366 0.07
367 0.07
368 0.07
369 0.07
370 0.07
371 0.07
372 0.07
373 0.07
374 0.07
375 0.07
376 0.07
377 0.07
378 0.07