Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7NK34

Protein Details
Accession A0A1C7NK34    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
132-153AKALSHKCSAKKKKQHTYTAAYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
Amino Acid Sequences MSVRLNISWRGKKFFIEFGSLSELNNTTVNQLKVSCQRVVGIDAASFDLFAFGGELNLFVRPRMNNLELPLYTYELQPSCNVVLVENKNVLQELTGTKPQKDEGYLLTQLDTIQVKLRQEIVPQIEQYEQQAKALSHKCSAKKKKQHTYTAAYLSEQLMHILFDLDSVICGPEAATAKQTRKQIVKQAQTLLDKTDEIKSIVNHISLEQQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.45
3 0.42
4 0.39
5 0.35
6 0.4
7 0.36
8 0.32
9 0.27
10 0.25
11 0.2
12 0.21
13 0.18
14 0.14
15 0.19
16 0.2
17 0.19
18 0.19
19 0.22
20 0.28
21 0.33
22 0.31
23 0.26
24 0.27
25 0.27
26 0.28
27 0.25
28 0.18
29 0.14
30 0.14
31 0.14
32 0.12
33 0.11
34 0.08
35 0.07
36 0.06
37 0.05
38 0.05
39 0.04
40 0.05
41 0.04
42 0.05
43 0.05
44 0.07
45 0.07
46 0.07
47 0.1
48 0.1
49 0.14
50 0.2
51 0.22
52 0.22
53 0.24
54 0.28
55 0.25
56 0.27
57 0.24
58 0.21
59 0.19
60 0.17
61 0.18
62 0.13
63 0.14
64 0.12
65 0.13
66 0.11
67 0.12
68 0.12
69 0.1
70 0.16
71 0.17
72 0.18
73 0.18
74 0.18
75 0.16
76 0.16
77 0.15
78 0.09
79 0.08
80 0.08
81 0.11
82 0.16
83 0.17
84 0.18
85 0.19
86 0.19
87 0.19
88 0.18
89 0.16
90 0.12
91 0.16
92 0.16
93 0.15
94 0.15
95 0.14
96 0.13
97 0.13
98 0.11
99 0.07
100 0.09
101 0.11
102 0.11
103 0.12
104 0.15
105 0.14
106 0.15
107 0.19
108 0.19
109 0.19
110 0.19
111 0.2
112 0.17
113 0.17
114 0.19
115 0.19
116 0.15
117 0.14
118 0.16
119 0.15
120 0.22
121 0.26
122 0.26
123 0.26
124 0.32
125 0.39
126 0.47
127 0.58
128 0.6
129 0.66
130 0.74
131 0.8
132 0.83
133 0.86
134 0.83
135 0.8
136 0.76
137 0.71
138 0.62
139 0.52
140 0.44
141 0.34
142 0.28
143 0.21
144 0.15
145 0.09
146 0.08
147 0.08
148 0.07
149 0.06
150 0.05
151 0.06
152 0.05
153 0.05
154 0.05
155 0.06
156 0.05
157 0.05
158 0.05
159 0.08
160 0.11
161 0.11
162 0.16
163 0.21
164 0.26
165 0.31
166 0.36
167 0.39
168 0.44
169 0.49
170 0.55
171 0.6
172 0.64
173 0.64
174 0.66
175 0.65
176 0.63
177 0.58
178 0.5
179 0.42
180 0.34
181 0.31
182 0.29
183 0.24
184 0.21
185 0.23
186 0.21
187 0.25
188 0.27
189 0.26
190 0.23
191 0.22