Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1G990

Protein Details
Accession C1G990    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
23-50LRENKAQALPRQRRRRFRARQNHQLLPSHydrophilic
NLS Segment(s)
PositionSequence
30-40ALPRQRRRRFR
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
KEGG pbn:PADG_03826  -  
Amino Acid Sequences MKPPASTTLSTVVKELRRLTKLLRENKAQALPRQRRRRFRARQNHQLLPSLLLDRQDDSRVRLLQSSQDLRQGKPPVVSILNFNICPWEEEDEEEAGKKMNWKWKIDGIKKRDTDGERETWNIGHAGWKTHGGLESGSLIIGISSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.38
4 0.37
5 0.39
6 0.42
7 0.45
8 0.51
9 0.56
10 0.56
11 0.55
12 0.57
13 0.61
14 0.63
15 0.58
16 0.56
17 0.58
18 0.62
19 0.66
20 0.73
21 0.76
22 0.79
23 0.83
24 0.87
25 0.87
26 0.88
27 0.88
28 0.87
29 0.89
30 0.87
31 0.85
32 0.76
33 0.7
34 0.59
35 0.5
36 0.42
37 0.32
38 0.25
39 0.19
40 0.17
41 0.14
42 0.15
43 0.16
44 0.15
45 0.16
46 0.2
47 0.2
48 0.2
49 0.19
50 0.19
51 0.19
52 0.23
53 0.24
54 0.2
55 0.26
56 0.27
57 0.27
58 0.32
59 0.31
60 0.27
61 0.25
62 0.24
63 0.2
64 0.2
65 0.19
66 0.15
67 0.17
68 0.17
69 0.16
70 0.15
71 0.14
72 0.13
73 0.14
74 0.13
75 0.13
76 0.11
77 0.13
78 0.14
79 0.14
80 0.14
81 0.13
82 0.12
83 0.09
84 0.09
85 0.12
86 0.14
87 0.22
88 0.27
89 0.3
90 0.34
91 0.41
92 0.51
93 0.57
94 0.62
95 0.6
96 0.64
97 0.63
98 0.61
99 0.61
100 0.53
101 0.51
102 0.47
103 0.45
104 0.38
105 0.38
106 0.37
107 0.3
108 0.29
109 0.22
110 0.17
111 0.17
112 0.16
113 0.18
114 0.18
115 0.21
116 0.2
117 0.22
118 0.23
119 0.19
120 0.18
121 0.16
122 0.16
123 0.14
124 0.13
125 0.1
126 0.09