Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NCJ6

Protein Details
Accession A0A1C7NCJ6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-37MCDRYKYQQRKTETKSNKKQHDKKKAALYRRRKVHydrophilic
NLS Segment(s)
PositionSequence
18-36KSNKKQHDKKKAALYRRRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MVVMCDRYKYQQRKTETKSNKKQHDKKKAALYRRRKVDETSSAANVFTVCEEPSQLLDLIVMSMYEVLPSDKSESLLIDAKDLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.79
4 0.81
5 0.83
6 0.85
7 0.88
8 0.89
9 0.91
10 0.91
11 0.91
12 0.87
13 0.84
14 0.85
15 0.82
16 0.81
17 0.81
18 0.81
19 0.78
20 0.8
21 0.77
22 0.68
23 0.63
24 0.6
25 0.57
26 0.51
27 0.45
28 0.37
29 0.33
30 0.31
31 0.27
32 0.2
33 0.13
34 0.08
35 0.07
36 0.05
37 0.05
38 0.06
39 0.06
40 0.07
41 0.08
42 0.08
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.05
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.06
56 0.08
57 0.11
58 0.12
59 0.13
60 0.14
61 0.14
62 0.17
63 0.22
64 0.21