Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MUC2

Protein Details
Accession A0A1C7MUC2    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-90PAFLRNWNVNKKRKFKPKPSSNSPAKRQRRSGPDKHydrophilic
NLS Segment(s)
PositionSequence
66-90KKRKFKPKPSSNSPAKRQRRSGPDK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.166, cyto 3
Family & Domain DBs
Amino Acid Sequences MSFSITTSEHPHFKALHRTKGNTEQNTTCIKIVMATSIGVLSNQGNLDFANTEEIPAFLRNWNVNKKRKFKPKPSSNSPAKRQRRSGPDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.49
4 0.51
5 0.53
6 0.56
7 0.65
8 0.69
9 0.62
10 0.6
11 0.51
12 0.49
13 0.5
14 0.45
15 0.35
16 0.26
17 0.21
18 0.17
19 0.15
20 0.12
21 0.09
22 0.07
23 0.07
24 0.07
25 0.07
26 0.06
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.06
35 0.05
36 0.05
37 0.08
38 0.07
39 0.08
40 0.08
41 0.08
42 0.09
43 0.09
44 0.1
45 0.08
46 0.11
47 0.15
48 0.2
49 0.3
50 0.38
51 0.47
52 0.55
53 0.63
54 0.7
55 0.78
56 0.83
57 0.84
58 0.86
59 0.88
60 0.89
61 0.9
62 0.9
63 0.9
64 0.89
65 0.88
66 0.87
67 0.87
68 0.86
69 0.85
70 0.84