Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NMF8

Protein Details
Accession A0A1C7NMF8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-30FINTLKRTRSTKKKNQYWVDHAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MISKLTLFINTLKRTRSTKKKNQYWVDHAQEAFGGTAENMRVLLSTLTVSESHTEMSVSLFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.57
4 0.59
5 0.65
6 0.72
7 0.79
8 0.84
9 0.87
10 0.85
11 0.81
12 0.79
13 0.73
14 0.65
15 0.56
16 0.46
17 0.36
18 0.29
19 0.21
20 0.12
21 0.07
22 0.04
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.04
29 0.05
30 0.05
31 0.05
32 0.05
33 0.06
34 0.07
35 0.07
36 0.08
37 0.09
38 0.1
39 0.1
40 0.1
41 0.1
42 0.09