Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N6P0

Protein Details
Accession A0A1C7N6P0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
46-65KSKAVQRKVASNKKRKRSDGBasic
NLS Segment(s)
PositionSequence
46-62KSKAVQRKVASNKKRKR
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MHIRRNFGRFKRGESAKVELSNNRGITVTIVEAICEKGMIDLTLRKSKAVQRKVASNKKRKRSDGASDGVAATVKSGTRSEHFLEFIEGISIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.51
4 0.53
5 0.48
6 0.41
7 0.4
8 0.4
9 0.36
10 0.31
11 0.26
12 0.21
13 0.2
14 0.18
15 0.14
16 0.1
17 0.09
18 0.09
19 0.09
20 0.09
21 0.08
22 0.07
23 0.06
24 0.04
25 0.05
26 0.05
27 0.05
28 0.08
29 0.12
30 0.17
31 0.17
32 0.17
33 0.19
34 0.26
35 0.34
36 0.37
37 0.41
38 0.38
39 0.47
40 0.57
41 0.65
42 0.69
43 0.71
44 0.73
45 0.76
46 0.82
47 0.77
48 0.75
49 0.73
50 0.72
51 0.69
52 0.64
53 0.55
54 0.47
55 0.43
56 0.35
57 0.27
58 0.18
59 0.11
60 0.08
61 0.07
62 0.08
63 0.09
64 0.12
65 0.14
66 0.19
67 0.21
68 0.23
69 0.24
70 0.23
71 0.25
72 0.23
73 0.21