Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N4R5

Protein Details
Accession A0A1C7N4R5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-78KPIQQKHKVVKKTPKRKPPTHKPKPEHSATABasic
NLS Segment(s)
PositionSequence
53-72KHKVVKKTPKRKPPTHKPKP
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
CDD cd22851  SMN_N  
Amino Acid Sequences MDELAIGTVLYTQGDAKHEDIWDDTELIEHWDRSIEAYRQMQSTQGNKPIQQKHKVVKKTPKRKPPTHKPKPEHSATALDQGKFHRGYETEEND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.15
5 0.16
6 0.16
7 0.17
8 0.17
9 0.16
10 0.14
11 0.13
12 0.11
13 0.11
14 0.13
15 0.13
16 0.1
17 0.09
18 0.1
19 0.1
20 0.11
21 0.15
22 0.13
23 0.16
24 0.19
25 0.2
26 0.2
27 0.21
28 0.21
29 0.21
30 0.24
31 0.23
32 0.28
33 0.28
34 0.3
35 0.38
36 0.43
37 0.47
38 0.5
39 0.52
40 0.53
41 0.61
42 0.64
43 0.65
44 0.68
45 0.72
46 0.76
47 0.79
48 0.81
49 0.82
50 0.86
51 0.88
52 0.89
53 0.89
54 0.9
55 0.91
56 0.87
57 0.88
58 0.86
59 0.81
60 0.74
61 0.66
62 0.62
63 0.52
64 0.55
65 0.49
66 0.41
67 0.38
68 0.35
69 0.38
70 0.32
71 0.31
72 0.26
73 0.23
74 0.3