Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7NGB8

Protein Details
Accession A0A1C7NGB8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
78-101QMESTLEYRKKKRKQEEGIANMTPHydrophilic
NLS Segment(s)
PositionSequence
88-90KKR
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027801  CENP-P  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0034080  P:CENP-A containing chromatin assembly  
Pfam View protein in Pfam  
PF13096  CENP-P  
Amino Acid Sequences MSSLYSIESEEGLAFDNRTSNANFQERLLEAQLQQNTNQSNAIVRLDSLFQSQDPEELKRQLIELESQVKKVEAEVSQMESTLEYRKKKRKQEEGIANMTPEQRALYYKKEQKRLDAKQRKIEEAMALTEIEKPLEEMLESDSDDDVEDELKKTRKKLIANKDVMSSAGSSDSDNEEQGYGDIEEQGVKPDWDIIYEYMLLLSDAFEDPNSLIDSRMLETNMDLKQKAFTHPEVLRQTDYSGIQFTKAKNTLMFDTKDGDIRSCQLAGTCYGQEFSITFDVREPEMVLSNIEFDVEFEMQLDVGSVLQQVKEESNIMGFFRLFVHYTELVHQRQLVFEKLSKQFENSNIKAEILSSSRIQFEGSLECAVMLVFTWKIDAFNNDLDVLDANVENHVEPLLTLEAIAHSEVIEKDKNNVLSKVNESFMFILKELGVCRAVEKVVNGILF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.14
4 0.14
5 0.17
6 0.19
7 0.2
8 0.27
9 0.32
10 0.32
11 0.3
12 0.34
13 0.33
14 0.34
15 0.33
16 0.28
17 0.24
18 0.3
19 0.35
20 0.32
21 0.32
22 0.34
23 0.32
24 0.3
25 0.29
26 0.22
27 0.2
28 0.21
29 0.22
30 0.17
31 0.16
32 0.16
33 0.17
34 0.18
35 0.17
36 0.16
37 0.14
38 0.17
39 0.17
40 0.2
41 0.21
42 0.24
43 0.27
44 0.29
45 0.3
46 0.27
47 0.27
48 0.25
49 0.24
50 0.23
51 0.23
52 0.28
53 0.29
54 0.29
55 0.29
56 0.27
57 0.26
58 0.24
59 0.23
60 0.15
61 0.18
62 0.19
63 0.22
64 0.22
65 0.22
66 0.21
67 0.17
68 0.17
69 0.21
70 0.25
71 0.28
72 0.38
73 0.48
74 0.57
75 0.67
76 0.76
77 0.79
78 0.83
79 0.87
80 0.88
81 0.85
82 0.83
83 0.73
84 0.63
85 0.55
86 0.46
87 0.35
88 0.24
89 0.17
90 0.12
91 0.15
92 0.18
93 0.22
94 0.31
95 0.4
96 0.47
97 0.56
98 0.57
99 0.63
100 0.7
101 0.74
102 0.76
103 0.77
104 0.77
105 0.77
106 0.79
107 0.73
108 0.64
109 0.56
110 0.47
111 0.38
112 0.32
113 0.23
114 0.19
115 0.16
116 0.16
117 0.14
118 0.11
119 0.09
120 0.08
121 0.07
122 0.07
123 0.07
124 0.05
125 0.07
126 0.08
127 0.08
128 0.09
129 0.09
130 0.08
131 0.08
132 0.08
133 0.06
134 0.06
135 0.07
136 0.07
137 0.11
138 0.17
139 0.19
140 0.21
141 0.29
142 0.34
143 0.41
144 0.5
145 0.57
146 0.63
147 0.66
148 0.65
149 0.59
150 0.53
151 0.45
152 0.36
153 0.25
154 0.15
155 0.1
156 0.09
157 0.07
158 0.08
159 0.11
160 0.11
161 0.1
162 0.1
163 0.09
164 0.09
165 0.09
166 0.09
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.08
174 0.08
175 0.07
176 0.07
177 0.09
178 0.09
179 0.09
180 0.1
181 0.08
182 0.09
183 0.09
184 0.09
185 0.07
186 0.07
187 0.06
188 0.05
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.06
197 0.07
198 0.06
199 0.06
200 0.07
201 0.08
202 0.08
203 0.09
204 0.08
205 0.07
206 0.07
207 0.11
208 0.13
209 0.14
210 0.13
211 0.12
212 0.15
213 0.16
214 0.19
215 0.18
216 0.17
217 0.22
218 0.23
219 0.3
220 0.3
221 0.31
222 0.29
223 0.25
224 0.25
225 0.21
226 0.2
227 0.13
228 0.13
229 0.11
230 0.12
231 0.14
232 0.14
233 0.19
234 0.2
235 0.2
236 0.19
237 0.21
238 0.23
239 0.24
240 0.25
241 0.19
242 0.2
243 0.2
244 0.22
245 0.2
246 0.18
247 0.14
248 0.15
249 0.15
250 0.12
251 0.12
252 0.09
253 0.1
254 0.11
255 0.12
256 0.11
257 0.1
258 0.1
259 0.1
260 0.1
261 0.09
262 0.1
263 0.11
264 0.11
265 0.11
266 0.12
267 0.14
268 0.14
269 0.14
270 0.12
271 0.09
272 0.1
273 0.1
274 0.09
275 0.08
276 0.09
277 0.08
278 0.07
279 0.07
280 0.05
281 0.08
282 0.08
283 0.07
284 0.07
285 0.07
286 0.07
287 0.07
288 0.07
289 0.04
290 0.04
291 0.04
292 0.05
293 0.05
294 0.06
295 0.06
296 0.07
297 0.08
298 0.09
299 0.09
300 0.08
301 0.09
302 0.1
303 0.1
304 0.1
305 0.09
306 0.09
307 0.09
308 0.11
309 0.1
310 0.1
311 0.15
312 0.15
313 0.16
314 0.2
315 0.25
316 0.25
317 0.25
318 0.26
319 0.21
320 0.23
321 0.25
322 0.23
323 0.2
324 0.22
325 0.28
326 0.32
327 0.37
328 0.35
329 0.35
330 0.36
331 0.42
332 0.48
333 0.42
334 0.42
335 0.37
336 0.37
337 0.34
338 0.31
339 0.25
340 0.17
341 0.19
342 0.15
343 0.16
344 0.17
345 0.17
346 0.17
347 0.15
348 0.15
349 0.15
350 0.15
351 0.14
352 0.13
353 0.12
354 0.12
355 0.11
356 0.09
357 0.06
358 0.06
359 0.06
360 0.06
361 0.07
362 0.07
363 0.09
364 0.1
365 0.13
366 0.15
367 0.16
368 0.18
369 0.17
370 0.17
371 0.16
372 0.15
373 0.13
374 0.11
375 0.09
376 0.08
377 0.08
378 0.09
379 0.08
380 0.08
381 0.08
382 0.06
383 0.06
384 0.08
385 0.09
386 0.08
387 0.08
388 0.08
389 0.08
390 0.09
391 0.1
392 0.07
393 0.06
394 0.09
395 0.1
396 0.14
397 0.17
398 0.17
399 0.21
400 0.27
401 0.33
402 0.35
403 0.37
404 0.37
405 0.38
406 0.43
407 0.43
408 0.39
409 0.34
410 0.32
411 0.31
412 0.31
413 0.28
414 0.23
415 0.2
416 0.18
417 0.2
418 0.18
419 0.19
420 0.17
421 0.15
422 0.16
423 0.17
424 0.17
425 0.17
426 0.18
427 0.18