Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NAT2

Protein Details
Accession A0A1C7NAT2    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-95FKKPTEQLKKTPTTKRRHSFSHydrophilic
316-335IEKKKSWPSHNGKVLHRNKSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013717  PIG-P  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08510  PIG-P  
Amino Acid Sequences MPINEVKNKPSLQPYLSHQLTAERLLSKNALTFQTSRSTSSLPSLVSYNNSSNHLKPTQVNAMRRGYSQEPTRSFKKPTEQLKKTPTTKRRHSFSNFLAIKFAKKPITDDSKQTAALTATNIITFSNSTLAGNKPLSTTQQAKKGHRPRSYSELPYNLPQVERAPPVAITNKTPAYEYYGFVMYLSSFVVFGIYILWAYLPDGVLDQLGITYYPSRYWALAIPIWLMTFVWFIFLSFMAINLMNTPSFDSIXCITDEHANVMCMDKEMISDRPPDWMPELYDIPIGLVNTILYQEESRMPSIRSRVIRAYDEEPSLIEKKKSWPSHNGKVLHRNKSYWLEAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.49
4 0.45
5 0.37
6 0.36
7 0.36
8 0.34
9 0.31
10 0.24
11 0.24
12 0.26
13 0.27
14 0.23
15 0.24
16 0.25
17 0.24
18 0.24
19 0.25
20 0.25
21 0.32
22 0.32
23 0.32
24 0.31
25 0.3
26 0.28
27 0.3
28 0.3
29 0.22
30 0.22
31 0.21
32 0.2
33 0.22
34 0.24
35 0.24
36 0.23
37 0.28
38 0.29
39 0.3
40 0.35
41 0.33
42 0.33
43 0.32
44 0.36
45 0.41
46 0.45
47 0.48
48 0.47
49 0.51
50 0.5
51 0.48
52 0.47
53 0.4
54 0.39
55 0.42
56 0.44
57 0.44
58 0.48
59 0.52
60 0.52
61 0.52
62 0.52
63 0.54
64 0.54
65 0.59
66 0.65
67 0.66
68 0.7
69 0.75
70 0.78
71 0.77
72 0.79
73 0.77
74 0.76
75 0.8
76 0.8
77 0.76
78 0.76
79 0.74
80 0.72
81 0.66
82 0.67
83 0.58
84 0.5
85 0.49
86 0.41
87 0.38
88 0.32
89 0.33
90 0.26
91 0.24
92 0.27
93 0.3
94 0.39
95 0.37
96 0.4
97 0.4
98 0.39
99 0.39
100 0.36
101 0.3
102 0.21
103 0.2
104 0.16
105 0.13
106 0.1
107 0.1
108 0.1
109 0.08
110 0.08
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.09
117 0.1
118 0.13
119 0.13
120 0.13
121 0.13
122 0.13
123 0.15
124 0.18
125 0.24
126 0.24
127 0.32
128 0.38
129 0.42
130 0.51
131 0.58
132 0.63
133 0.63
134 0.64
135 0.59
136 0.61
137 0.63
138 0.58
139 0.53
140 0.47
141 0.42
142 0.39
143 0.37
144 0.29
145 0.23
146 0.19
147 0.17
148 0.16
149 0.15
150 0.14
151 0.12
152 0.12
153 0.13
154 0.16
155 0.15
156 0.14
157 0.17
158 0.17
159 0.17
160 0.17
161 0.16
162 0.19
163 0.19
164 0.18
165 0.16
166 0.16
167 0.15
168 0.15
169 0.15
170 0.08
171 0.07
172 0.06
173 0.05
174 0.04
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.03
195 0.03
196 0.03
197 0.03
198 0.05
199 0.05
200 0.06
201 0.08
202 0.09
203 0.09
204 0.11
205 0.12
206 0.14
207 0.14
208 0.15
209 0.13
210 0.13
211 0.12
212 0.11
213 0.09
214 0.07
215 0.06
216 0.06
217 0.06
218 0.06
219 0.06
220 0.07
221 0.07
222 0.08
223 0.07
224 0.07
225 0.07
226 0.07
227 0.07
228 0.07
229 0.08
230 0.07
231 0.07
232 0.09
233 0.09
234 0.09
235 0.09
236 0.09
237 0.1
238 0.11
239 0.12
240 0.13
241 0.15
242 0.15
243 0.17
244 0.16
245 0.15
246 0.14
247 0.15
248 0.12
249 0.1
250 0.1
251 0.08
252 0.09
253 0.11
254 0.13
255 0.14
256 0.17
257 0.17
258 0.21
259 0.22
260 0.22
261 0.23
262 0.23
263 0.23
264 0.24
265 0.25
266 0.21
267 0.21
268 0.19
269 0.16
270 0.15
271 0.13
272 0.09
273 0.08
274 0.07
275 0.07
276 0.07
277 0.07
278 0.07
279 0.07
280 0.09
281 0.13
282 0.16
283 0.18
284 0.2
285 0.21
286 0.25
287 0.3
288 0.36
289 0.36
290 0.39
291 0.43
292 0.45
293 0.48
294 0.47
295 0.46
296 0.43
297 0.41
298 0.36
299 0.3
300 0.3
301 0.3
302 0.29
303 0.27
304 0.26
305 0.32
306 0.42
307 0.5
308 0.52
309 0.59
310 0.64
311 0.73
312 0.78
313 0.77
314 0.76
315 0.78
316 0.81
317 0.8
318 0.75
319 0.67
320 0.66
321 0.66