Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N226

Protein Details
Accession A0A1C7N226    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
178-201QGNNSPHKGKKRAPRKCQLCGNFSHydrophilic
NLS Segment(s)
PositionSequence
186-193KGKKRAPR
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, cyto 8, cyto_mito 7.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MLSDSXENVKYVYLKSSNGSVNFGLMAAAWSELCSSSNYIYYKTPEHLYSYYNTLEDRKKYRDSVPYNIDASRSIRLLGQCKRRYVSSEQAKKYRRLEPSLLICISIASTSTTEAVEEAPVNVALKPTAIEPPIEMVEPSINTTGSLENEVSNIADNQTNETYYTIDDQITEVLSASSQGNNSPHKGKKRAPRKCQLCGNFSPTCKGSSKPKLCQFKCGICARKKCAARYGGDRKCILSATTEAVNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.33
4 0.32
5 0.34
6 0.27
7 0.25
8 0.23
9 0.21
10 0.16
11 0.1
12 0.09
13 0.06
14 0.06
15 0.05
16 0.05
17 0.06
18 0.07
19 0.07
20 0.09
21 0.1
22 0.11
23 0.16
24 0.17
25 0.19
26 0.21
27 0.24
28 0.25
29 0.26
30 0.28
31 0.25
32 0.29
33 0.28
34 0.27
35 0.26
36 0.27
37 0.25
38 0.23
39 0.22
40 0.22
41 0.27
42 0.31
43 0.35
44 0.37
45 0.4
46 0.43
47 0.48
48 0.53
49 0.53
50 0.55
51 0.55
52 0.53
53 0.51
54 0.48
55 0.42
56 0.34
57 0.3
58 0.24
59 0.19
60 0.15
61 0.15
62 0.18
63 0.24
64 0.3
65 0.38
66 0.4
67 0.44
68 0.45
69 0.44
70 0.45
71 0.45
72 0.48
73 0.48
74 0.53
75 0.55
76 0.62
77 0.64
78 0.66
79 0.65
80 0.61
81 0.56
82 0.52
83 0.5
84 0.48
85 0.49
86 0.47
87 0.42
88 0.35
89 0.29
90 0.23
91 0.2
92 0.13
93 0.09
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.05
113 0.05
114 0.07
115 0.07
116 0.07
117 0.07
118 0.09
119 0.09
120 0.09
121 0.08
122 0.07
123 0.07
124 0.07
125 0.08
126 0.07
127 0.07
128 0.07
129 0.08
130 0.08
131 0.08
132 0.09
133 0.08
134 0.08
135 0.08
136 0.08
137 0.07
138 0.07
139 0.07
140 0.06
141 0.08
142 0.08
143 0.11
144 0.11
145 0.11
146 0.11
147 0.12
148 0.11
149 0.1
150 0.12
151 0.1
152 0.09
153 0.09
154 0.09
155 0.09
156 0.09
157 0.08
158 0.06
159 0.05
160 0.05
161 0.06
162 0.06
163 0.07
164 0.07
165 0.1
166 0.14
167 0.16
168 0.2
169 0.26
170 0.32
171 0.4
172 0.47
173 0.52
174 0.58
175 0.67
176 0.74
177 0.77
178 0.82
179 0.82
180 0.83
181 0.85
182 0.82
183 0.78
184 0.72
185 0.69
186 0.63
187 0.56
188 0.52
189 0.43
190 0.41
191 0.35
192 0.33
193 0.37
194 0.43
195 0.5
196 0.55
197 0.63
198 0.71
199 0.7
200 0.76
201 0.73
202 0.7
203 0.69
204 0.69
205 0.69
206 0.67
207 0.75
208 0.72
209 0.74
210 0.72
211 0.69
212 0.68
213 0.65
214 0.62
215 0.64
216 0.68
217 0.67
218 0.67
219 0.63
220 0.56
221 0.52
222 0.47
223 0.37
224 0.3
225 0.25
226 0.22