Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NHS1

Protein Details
Accession A0A1C7NHS1    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-37PDAFSSKKQYKEKKLLNFSQNQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, mito_nucl 12.333, cyto_mito 9.333, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044996  COQ10-like  
IPR005031  COQ10_START  
IPR023393  START-like_dom_sf  
Gene Ontology GO:0048039  F:ubiquinone binding  
GO:0045333  P:cellular respiration  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF03364  Polyketide_cyc  
CDD cd07813  COQ10p_like  
Amino Acid Sequences MTTLLRPQRRHFFSIPDAFSSKKQYKEKKLLNFSQNQIYNVVSNVNDYKFFVPFCNHSHVYTSTPLRDGSYLMKAELGVGFKLFEEKYMSKVTCRKPTVVKAVAADAALFNDMTTTWQFTPNLPPSKLNSSSSADHPSCWVDFDISFEFASPIHAQASSVFFDQHVFGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.58
3 0.52
4 0.49
5 0.44
6 0.44
7 0.46
8 0.43
9 0.43
10 0.5
11 0.56
12 0.64
13 0.72
14 0.78
15 0.79
16 0.83
17 0.83
18 0.82
19 0.79
20 0.72
21 0.7
22 0.64
23 0.55
24 0.47
25 0.39
26 0.31
27 0.24
28 0.22
29 0.13
30 0.13
31 0.14
32 0.13
33 0.13
34 0.14
35 0.15
36 0.15
37 0.15
38 0.15
39 0.15
40 0.18
41 0.2
42 0.26
43 0.26
44 0.25
45 0.28
46 0.28
47 0.28
48 0.29
49 0.28
50 0.22
51 0.22
52 0.22
53 0.19
54 0.18
55 0.16
56 0.14
57 0.16
58 0.15
59 0.14
60 0.13
61 0.12
62 0.12
63 0.12
64 0.1
65 0.06
66 0.06
67 0.06
68 0.06
69 0.08
70 0.07
71 0.07
72 0.1
73 0.11
74 0.13
75 0.17
76 0.17
77 0.19
78 0.26
79 0.32
80 0.37
81 0.38
82 0.39
83 0.4
84 0.46
85 0.51
86 0.47
87 0.43
88 0.34
89 0.33
90 0.31
91 0.26
92 0.2
93 0.11
94 0.08
95 0.07
96 0.06
97 0.04
98 0.04
99 0.04
100 0.06
101 0.06
102 0.09
103 0.09
104 0.13
105 0.14
106 0.15
107 0.23
108 0.3
109 0.36
110 0.34
111 0.36
112 0.37
113 0.44
114 0.47
115 0.41
116 0.37
117 0.35
118 0.36
119 0.37
120 0.41
121 0.34
122 0.31
123 0.3
124 0.28
125 0.24
126 0.23
127 0.2
128 0.14
129 0.14
130 0.18
131 0.18
132 0.17
133 0.17
134 0.15
135 0.15
136 0.13
137 0.17
138 0.14
139 0.12
140 0.12
141 0.12
142 0.12
143 0.14
144 0.17
145 0.16
146 0.15
147 0.15
148 0.14
149 0.15