Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7LS84

Protein Details
Accession A0A1C7LS84    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-57RYYHNKSRKEPQKSARKKASKNKSDKBasic
NLS Segment(s)
PositionSequence
37-67KSRKEPQKSARKKASKNKSDKGSKATKRQKK
Subcellular Location(s) nucl 21, mito_nucl 13.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences NAWKQLRTLADISRTPTYRYDDFWLENMILARYYHNKSRKEPQKSARKKASKNKSDKGSKATKRQKKVSAYMTMNSNKATLPRLHHRLNKNQYQVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.37
4 0.38
5 0.34
6 0.35
7 0.35
8 0.32
9 0.33
10 0.32
11 0.29
12 0.23
13 0.23
14 0.2
15 0.15
16 0.12
17 0.11
18 0.12
19 0.15
20 0.18
21 0.24
22 0.31
23 0.35
24 0.39
25 0.49
26 0.57
27 0.6
28 0.66
29 0.67
30 0.71
31 0.76
32 0.81
33 0.81
34 0.79
35 0.79
36 0.81
37 0.82
38 0.8
39 0.8
40 0.78
41 0.77
42 0.76
43 0.71
44 0.68
45 0.67
46 0.65
47 0.67
48 0.7
49 0.7
50 0.71
51 0.75
52 0.77
53 0.73
54 0.74
55 0.7
56 0.68
57 0.63
58 0.58
59 0.57
60 0.52
61 0.46
62 0.39
63 0.33
64 0.24
65 0.23
66 0.24
67 0.21
68 0.25
69 0.33
70 0.4
71 0.48
72 0.55
73 0.62
74 0.69
75 0.74
76 0.77
77 0.74