Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MYI8

Protein Details
Accession A0A1C7MYI8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-39VEQGYIKRFRPQKSKKRKANGPKATLSHydrophilic
NLS Segment(s)
PositionSequence
19-34KRFRPQKSKKRKANGP
Subcellular Location(s) nucl 20, mito_nucl 12.333, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019340  Histone_AcTrfase_su3  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF10198  Ada3  
Amino Acid Sequences QYRQVLDTLDSQVEQGYIKRFRPQKSKKRKANGPKATLSENTLYAMEKRKTWIDALGGIFRDKNMTMPKTSIYEEHNHDIYSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.16
4 0.2
5 0.21
6 0.29
7 0.35
8 0.42
9 0.52
10 0.61
11 0.65
12 0.72
13 0.81
14 0.83
15 0.87
16 0.9
17 0.9
18 0.9
19 0.89
20 0.84
21 0.77
22 0.7
23 0.62
24 0.53
25 0.44
26 0.34
27 0.25
28 0.19
29 0.15
30 0.13
31 0.12
32 0.18
33 0.16
34 0.16
35 0.18
36 0.19
37 0.2
38 0.2
39 0.21
40 0.16
41 0.19
42 0.2
43 0.2
44 0.19
45 0.19
46 0.18
47 0.15
48 0.16
49 0.12
50 0.15
51 0.2
52 0.22
53 0.24
54 0.25
55 0.28
56 0.29
57 0.31
58 0.29
59 0.26
60 0.3
61 0.33
62 0.37
63 0.36