Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NS64

Protein Details
Accession A0A1C7NS64    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-36TKTTKRAATAKPEEKKRRAKKDPSAPKRSLSHydrophilic
NLS Segment(s)
PositionSequence
10-33KRAATAKPEEKKRRAKKDPSAPKR
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKETTKTTKRAATAKPEEKKRRAKKDPSAPKRSLSAYMFFSQEWRETIKKENPEATFGQLGKLLGEKWKSMDEEEKKPYVEMAEADKKRYESEKASAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.7
4 0.75
5 0.8
6 0.81
7 0.86
8 0.86
9 0.86
10 0.87
11 0.88
12 0.88
13 0.89
14 0.91
15 0.9
16 0.89
17 0.8
18 0.73
19 0.66
20 0.58
21 0.52
22 0.43
23 0.35
24 0.3
25 0.29
26 0.27
27 0.23
28 0.22
29 0.18
30 0.17
31 0.14
32 0.14
33 0.14
34 0.14
35 0.21
36 0.25
37 0.28
38 0.3
39 0.34
40 0.32
41 0.34
42 0.34
43 0.3
44 0.28
45 0.23
46 0.21
47 0.17
48 0.16
49 0.13
50 0.12
51 0.1
52 0.11
53 0.13
54 0.13
55 0.13
56 0.16
57 0.17
58 0.18
59 0.27
60 0.29
61 0.35
62 0.4
63 0.41
64 0.39
65 0.38
66 0.36
67 0.28
68 0.24
69 0.18
70 0.21
71 0.29
72 0.29
73 0.32
74 0.34
75 0.34
76 0.36
77 0.38
78 0.36
79 0.32