Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NR56

Protein Details
Accession A0A1C7NR56    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MGTVRQKRAAKNTNKNTRRTADRHKKRVTIHGNHydrophilic
NLS Segment(s)
PositionSequence
7-28KRAAKNTNKNTRRTADRHKKRV
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 2, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MGTVRQKRAAKNTNKNTRRTADRHKKRVTIHGNPIIKKNWDKKLTLKQNYEKLGLLTSLNGETGGKEKMKPDAPVEVEAETEPKDLKDMTEEEIEQLKKTLNPGEGLIQRDDEGNIVRIIVGEKKSHDEILDAEVPKVEAKTDVVRQLEELAANAVHHEKYQSEYETDWVQKLINKHGDDYKAMFWDKDLNIYQQTAAQLKKKCQAYAQKNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.81
4 0.78
5 0.77
6 0.74
7 0.74
8 0.74
9 0.78
10 0.83
11 0.83
12 0.83
13 0.78
14 0.81
15 0.79
16 0.77
17 0.76
18 0.75
19 0.74
20 0.69
21 0.69
22 0.63
23 0.59
24 0.58
25 0.56
26 0.56
27 0.54
28 0.55
29 0.59
30 0.66
31 0.71
32 0.71
33 0.72
34 0.7
35 0.73
36 0.73
37 0.66
38 0.56
39 0.46
40 0.38
41 0.29
42 0.22
43 0.15
44 0.12
45 0.1
46 0.09
47 0.09
48 0.07
49 0.07
50 0.09
51 0.11
52 0.11
53 0.12
54 0.13
55 0.18
56 0.22
57 0.23
58 0.23
59 0.27
60 0.27
61 0.28
62 0.28
63 0.23
64 0.2
65 0.18
66 0.17
67 0.12
68 0.1
69 0.08
70 0.07
71 0.08
72 0.07
73 0.07
74 0.09
75 0.1
76 0.11
77 0.13
78 0.13
79 0.13
80 0.17
81 0.18
82 0.15
83 0.14
84 0.12
85 0.11
86 0.13
87 0.15
88 0.12
89 0.12
90 0.13
91 0.17
92 0.19
93 0.2
94 0.19
95 0.16
96 0.15
97 0.14
98 0.14
99 0.1
100 0.08
101 0.07
102 0.07
103 0.06
104 0.06
105 0.06
106 0.07
107 0.09
108 0.1
109 0.1
110 0.11
111 0.15
112 0.16
113 0.16
114 0.15
115 0.13
116 0.12
117 0.15
118 0.19
119 0.16
120 0.15
121 0.15
122 0.15
123 0.15
124 0.14
125 0.1
126 0.06
127 0.07
128 0.11
129 0.14
130 0.19
131 0.19
132 0.19
133 0.2
134 0.2
135 0.19
136 0.15
137 0.13
138 0.09
139 0.08
140 0.08
141 0.08
142 0.09
143 0.08
144 0.08
145 0.09
146 0.08
147 0.12
148 0.15
149 0.16
150 0.16
151 0.17
152 0.19
153 0.23
154 0.23
155 0.21
156 0.18
157 0.17
158 0.19
159 0.21
160 0.27
161 0.3
162 0.3
163 0.32
164 0.38
165 0.39
166 0.39
167 0.39
168 0.34
169 0.31
170 0.31
171 0.27
172 0.23
173 0.28
174 0.25
175 0.28
176 0.28
177 0.27
178 0.28
179 0.29
180 0.28
181 0.24
182 0.27
183 0.25
184 0.27
185 0.31
186 0.34
187 0.39
188 0.47
189 0.49
190 0.48
191 0.52
192 0.59
193 0.63