Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7MYJ2

Protein Details
Accession A0A1C7MYJ2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
55-76LLAKRVKESKQEKAERRRTSSMHydrophilic
NLS Segment(s)
PositionSequence
29-72QRKRHRQALKRRRAEASREAEAEYKQLLAKRVKESKQEKAERRR
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001377  Ribosomal_S6e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences REVQPKAEGKKAYTKAPKIQRLVTPLTLQRKRHRQALKRRRAEASREAEAEYKQLLAKRVKESKQEKAERRRTSSMQKSASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.67
4 0.72
5 0.66
6 0.68
7 0.63
8 0.59
9 0.57
10 0.5
11 0.44
12 0.42
13 0.48
14 0.49
15 0.5
16 0.53
17 0.58
18 0.59
19 0.64
20 0.67
21 0.67
22 0.72
23 0.77
24 0.79
25 0.77
26 0.77
27 0.74
28 0.68
29 0.64
30 0.61
31 0.56
32 0.48
33 0.41
34 0.38
35 0.34
36 0.31
37 0.26
38 0.18
39 0.13
40 0.11
41 0.13
42 0.17
43 0.21
44 0.26
45 0.33
46 0.41
47 0.45
48 0.53
49 0.57
50 0.62
51 0.68
52 0.72
53 0.74
54 0.77
55 0.82
56 0.81
57 0.83
58 0.8
59 0.76
60 0.77
61 0.78
62 0.76