Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7N0U1

Protein Details
Accession A0A1C7N0U1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
113-137DEVFKEHKKQQKDRDRKSTRLENRGBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 8, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR042225  Ncb2  
Gene Ontology GO:0017054  C:negative cofactor 2 complex  
GO:0140223  F:general transcription initiation factor activity  
GO:0046982  F:protein heterodimerization activity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSDSERAGNPVDDELSLPKATVQKLINEMMPDDIVCSKDTRDLLIDCCVGKTSETRGYFSMTDRFCLLSEFIHLIASEANEICEKETKKTIAGEHVLSALKELGFEDYMEEVDEVFKEHKKQQKDRDRKSTRLENRGISEEELLRQQELLFAQSRIKFEAQQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.16
4 0.14
5 0.16
6 0.19
7 0.19
8 0.24
9 0.24
10 0.24
11 0.28
12 0.3
13 0.29
14 0.26
15 0.25
16 0.2
17 0.19
18 0.15
19 0.12
20 0.12
21 0.11
22 0.11
23 0.11
24 0.11
25 0.15
26 0.15
27 0.15
28 0.17
29 0.17
30 0.18
31 0.2
32 0.21
33 0.17
34 0.17
35 0.16
36 0.14
37 0.13
38 0.13
39 0.14
40 0.21
41 0.22
42 0.23
43 0.23
44 0.26
45 0.26
46 0.26
47 0.28
48 0.21
49 0.21
50 0.19
51 0.19
52 0.16
53 0.17
54 0.15
55 0.08
56 0.1
57 0.09
58 0.09
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.06
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.1
71 0.11
72 0.13
73 0.16
74 0.16
75 0.17
76 0.2
77 0.2
78 0.2
79 0.22
80 0.2
81 0.17
82 0.19
83 0.17
84 0.15
85 0.14
86 0.1
87 0.08
88 0.07
89 0.07
90 0.06
91 0.06
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.08
103 0.1
104 0.13
105 0.2
106 0.26
107 0.35
108 0.44
109 0.54
110 0.63
111 0.72
112 0.79
113 0.84
114 0.85
115 0.83
116 0.83
117 0.83
118 0.81
119 0.79
120 0.75
121 0.69
122 0.65
123 0.62
124 0.56
125 0.46
126 0.4
127 0.32
128 0.29
129 0.27
130 0.23
131 0.19
132 0.17
133 0.16
134 0.16
135 0.15
136 0.17
137 0.15
138 0.15
139 0.21
140 0.24
141 0.26
142 0.27
143 0.29