Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0A0HVK6

Protein Details
Accession A0A0A0HVK6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MRGRTVRNPQKRRCQSPLKGQKPGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
KEGG pbn:PADG_12425  -  
Amino Acid Sequences MRGRTVRNPQKRRCQSPLKGQKPGISKRANIETQLTPILNIRRLEMMNGPLLKCVDVNEETPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.83
3 0.84
4 0.86
5 0.82
6 0.8
7 0.73
8 0.7
9 0.67
10 0.65
11 0.62
12 0.54
13 0.48
14 0.44
15 0.48
16 0.44
17 0.37
18 0.35
19 0.27
20 0.25
21 0.25
22 0.2
23 0.14
24 0.17
25 0.18
26 0.19
27 0.18
28 0.18
29 0.19
30 0.19
31 0.21
32 0.21
33 0.2
34 0.21
35 0.23
36 0.22
37 0.21
38 0.22
39 0.2
40 0.18
41 0.17
42 0.17
43 0.17