Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NHH5

Protein Details
Accession A0A1C7NHH5    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
95-120ALTPFEKSKKTVRQQKKEAHFPIRKYHydrophilic
NLS Segment(s)
PositionSequence
86-116VKKTRAMRRALTPFEKSKKTVRQQKKEAHFP
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MNFNTVAVKAHELRNKNKAELLKVLDEQKQQLANIRVQKVAGGRVQEVGEARKNVARVLTVINQTQREQLRLFYQKKRFTPLDLRVKKTRAMRRALTPFEKSKKTVRQQKKEAHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.49
4 0.51
5 0.48
6 0.46
7 0.46
8 0.44
9 0.39
10 0.38
11 0.4
12 0.4
13 0.38
14 0.35
15 0.32
16 0.3
17 0.26
18 0.29
19 0.29
20 0.29
21 0.34
22 0.35
23 0.31
24 0.29
25 0.31
26 0.25
27 0.26
28 0.22
29 0.17
30 0.16
31 0.17
32 0.17
33 0.16
34 0.15
35 0.15
36 0.16
37 0.15
38 0.15
39 0.15
40 0.15
41 0.14
42 0.14
43 0.11
44 0.09
45 0.12
46 0.15
47 0.15
48 0.16
49 0.18
50 0.19
51 0.19
52 0.23
53 0.21
54 0.19
55 0.18
56 0.18
57 0.22
58 0.3
59 0.34
60 0.38
61 0.46
62 0.51
63 0.52
64 0.58
65 0.53
66 0.5
67 0.54
68 0.55
69 0.58
70 0.57
71 0.61
72 0.6
73 0.61
74 0.6
75 0.6
76 0.6
77 0.56
78 0.57
79 0.55
80 0.58
81 0.64
82 0.66
83 0.63
84 0.6
85 0.61
86 0.61
87 0.6
88 0.54
89 0.56
90 0.59
91 0.64
92 0.69
93 0.71
94 0.75
95 0.81
96 0.88
97 0.88
98 0.88
99 0.87
100 0.86
101 0.83
102 0.76
103 0.76
104 0.75