Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GLC1

Protein Details
Accession C1GLC1   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKGLRSSVKQRNKAKLRAEVHydrophilic
77-104MTKPSSQHTHRIQKKVRRKTRPSITFAAHydrophilic
NLS Segment(s)
PositionSequence
88-116IQKKVRRKTRPSITFAAHPLKRKRLSKKK
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG pbn:PADG_08057  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSSVKQRNKAKLRAEVFGPVVDRRTERLSAKLVALASKPKEVNMDDAEKLDMSREAEDDERKDMDIDEPSGMTKPSSQHTHRIQKKVRRKTRPSITFAAHPLKRKRLSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.8
4 0.73
5 0.67
6 0.6
7 0.54
8 0.46
9 0.39
10 0.33
11 0.25
12 0.23
13 0.21
14 0.2
15 0.19
16 0.21
17 0.24
18 0.23
19 0.26
20 0.28
21 0.27
22 0.27
23 0.26
24 0.22
25 0.2
26 0.19
27 0.2
28 0.18
29 0.21
30 0.2
31 0.18
32 0.21
33 0.2
34 0.23
35 0.21
36 0.23
37 0.19
38 0.2
39 0.19
40 0.16
41 0.16
42 0.12
43 0.1
44 0.07
45 0.07
46 0.07
47 0.08
48 0.1
49 0.11
50 0.12
51 0.13
52 0.12
53 0.12
54 0.12
55 0.12
56 0.12
57 0.11
58 0.12
59 0.1
60 0.1
61 0.1
62 0.11
63 0.1
64 0.09
65 0.09
66 0.1
67 0.15
68 0.22
69 0.24
70 0.33
71 0.42
72 0.52
73 0.58
74 0.66
75 0.7
76 0.73
77 0.82
78 0.84
79 0.85
80 0.86
81 0.86
82 0.87
83 0.89
84 0.88
85 0.84
86 0.79
87 0.73
88 0.68
89 0.65
90 0.64
91 0.57
92 0.57
93 0.58
94 0.61
95 0.66
96 0.7