Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MTL6

Protein Details
Accession A0A1C7MTL6    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-102RNGVPVVEKKKRKKAAARRLPVPTRBasic
135-159DGVRDLRLQRPKRRRRHLMTYPGVRBasic
NLS Segment(s)
PositionSequence
86-97KKKRKKAAARRL
144-150RPKRRRR
Subcellular Location(s) cyto 14.5, cyto_nucl 13, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Pfam View protein in Pfam  
PF13975  gag-asp_proteas  
CDD cd00303  retropepsin_like  
Amino Acid Sequences LEAAGTPIEKPLNYFSAEVNLVDTINESELKEIYGVKRGRDLGSTTAMDSSKRIASGVGVLGPSVPPVLSSAPVQVARNGVPVVEKKKRKKAAARRLPVPTRALNIWDALSRVNAGLTLLDWAAMDPNAAQDLVDGVRDLRLQRPKRRRRHLMTYPGVRGGGAPLVSTGVAPVVGGTGGVQGVGVKVVEQVDSDSDGYDSDYAAMYDSEEVDLDTQEEGDSTIEGLKLSEAESIYQYPYSLNRMKISSPLRGVIHINGHPVEAIFDTSTGASVISKSLVNSLGLTPNGDSLHLVSFNKTASDKSEIVMNVPINIGDKICPDHMCVSDGGKDDPLCLLGVPWIQAYGVEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.21
3 0.25
4 0.26
5 0.23
6 0.2
7 0.18
8 0.15
9 0.14
10 0.14
11 0.1
12 0.11
13 0.12
14 0.11
15 0.12
16 0.12
17 0.12
18 0.12
19 0.15
20 0.15
21 0.22
22 0.24
23 0.24
24 0.3
25 0.33
26 0.33
27 0.33
28 0.34
29 0.29
30 0.33
31 0.32
32 0.27
33 0.28
34 0.27
35 0.24
36 0.22
37 0.21
38 0.17
39 0.16
40 0.16
41 0.12
42 0.13
43 0.15
44 0.15
45 0.14
46 0.11
47 0.11
48 0.11
49 0.11
50 0.1
51 0.08
52 0.06
53 0.05
54 0.07
55 0.08
56 0.09
57 0.1
58 0.11
59 0.14
60 0.17
61 0.18
62 0.17
63 0.19
64 0.18
65 0.2
66 0.18
67 0.14
68 0.15
69 0.2
70 0.27
71 0.34
72 0.42
73 0.49
74 0.59
75 0.67
76 0.73
77 0.78
78 0.81
79 0.84
80 0.85
81 0.84
82 0.81
83 0.82
84 0.78
85 0.71
86 0.65
87 0.55
88 0.48
89 0.41
90 0.36
91 0.28
92 0.24
93 0.21
94 0.17
95 0.15
96 0.12
97 0.11
98 0.09
99 0.08
100 0.07
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.05
116 0.05
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.07
126 0.08
127 0.14
128 0.23
129 0.3
130 0.4
131 0.52
132 0.61
133 0.7
134 0.8
135 0.84
136 0.83
137 0.86
138 0.85
139 0.85
140 0.83
141 0.78
142 0.69
143 0.6
144 0.52
145 0.41
146 0.31
147 0.21
148 0.14
149 0.08
150 0.06
151 0.05
152 0.05
153 0.06
154 0.05
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.07
180 0.07
181 0.06
182 0.06
183 0.06
184 0.06
185 0.06
186 0.05
187 0.05
188 0.05
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.04
204 0.04
205 0.05
206 0.04
207 0.04
208 0.04
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.05
215 0.06
216 0.07
217 0.07
218 0.07
219 0.09
220 0.1
221 0.1
222 0.1
223 0.1
224 0.09
225 0.1
226 0.16
227 0.19
228 0.21
229 0.22
230 0.24
231 0.25
232 0.31
233 0.34
234 0.33
235 0.31
236 0.32
237 0.3
238 0.31
239 0.32
240 0.27
241 0.29
242 0.24
243 0.25
244 0.21
245 0.2
246 0.18
247 0.17
248 0.15
249 0.1
250 0.1
251 0.07
252 0.07
253 0.08
254 0.08
255 0.08
256 0.07
257 0.06
258 0.05
259 0.06
260 0.06
261 0.07
262 0.08
263 0.08
264 0.1
265 0.11
266 0.11
267 0.12
268 0.13
269 0.15
270 0.15
271 0.16
272 0.14
273 0.15
274 0.15
275 0.14
276 0.13
277 0.11
278 0.13
279 0.15
280 0.15
281 0.14
282 0.15
283 0.16
284 0.18
285 0.17
286 0.16
287 0.17
288 0.23
289 0.22
290 0.2
291 0.26
292 0.23
293 0.24
294 0.28
295 0.24
296 0.19
297 0.19
298 0.19
299 0.15
300 0.16
301 0.14
302 0.11
303 0.13
304 0.15
305 0.18
306 0.18
307 0.19
308 0.23
309 0.24
310 0.25
311 0.24
312 0.24
313 0.25
314 0.27
315 0.25
316 0.25
317 0.23
318 0.22
319 0.22
320 0.2
321 0.15
322 0.13
323 0.12
324 0.11
325 0.13
326 0.13
327 0.12
328 0.12
329 0.11