Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7NRD6

Protein Details
Accession A0A1C7NRD6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-121ALTPFEKSKKTVRQQKKEAHFPIRKYHydrophilic
NLS Segment(s)
PositionSequence
87-117VKKTRAMRRALTPFEKSKKTVRQQKKEAHFP
Subcellular Location(s) mito 14, nucl 10, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MLFFVQAAVKAHELRNKNKAELLKVLDEQKQQLAAIRVQKVAGGRAQEVGEARKNVARVLTVINQTQREQLRLFYQKKRFTPLDLRVKKTRAMRRALTPFEKSKKTVRQQKKEAHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.45
3 0.46
4 0.45
5 0.48
6 0.48
7 0.46
8 0.46
9 0.44
10 0.39
11 0.38
12 0.4
13 0.4
14 0.38
15 0.35
16 0.3
17 0.26
18 0.22
19 0.23
20 0.21
21 0.21
22 0.25
23 0.25
24 0.24
25 0.23
26 0.25
27 0.22
28 0.21
29 0.19
30 0.14
31 0.13
32 0.14
33 0.14
34 0.14
35 0.14
36 0.15
37 0.16
38 0.15
39 0.15
40 0.15
41 0.15
42 0.14
43 0.14
44 0.11
45 0.09
46 0.12
47 0.15
48 0.15
49 0.16
50 0.18
51 0.19
52 0.19
53 0.23
54 0.21
55 0.19
56 0.18
57 0.18
58 0.22
59 0.3
60 0.34
61 0.38
62 0.46
63 0.51
64 0.52
65 0.58
66 0.53
67 0.5
68 0.54
69 0.55
70 0.58
71 0.57
72 0.61
73 0.6
74 0.61
75 0.6
76 0.6
77 0.6
78 0.56
79 0.57
80 0.55
81 0.58
82 0.64
83 0.66
84 0.63
85 0.6
86 0.61
87 0.61
88 0.61
89 0.55
90 0.56
91 0.59
92 0.64
93 0.69
94 0.71
95 0.75
96 0.81
97 0.88
98 0.88
99 0.88
100 0.87
101 0.86
102 0.83
103 0.76
104 0.76
105 0.75