Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7NPI0

Protein Details
Accession A0A1C7NPI0    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-124FQSHERQTENKPKKTKRPRLPTGWKVKSLHydrophilic
NLS Segment(s)
PositionSequence
106-117KPKKTKRPRLPT
Subcellular Location(s) nucl 17, mito_nucl 12.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR013085  U1-CZ_Znf_C2H2  
IPR036236  Znf_C2H2_sf  
IPR000571  Znf_CCCH  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PF06220  zf-U1  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MARNYFCDFCQCTFPDNPTNRKSHNEGTVHINNRKLHYDWYKDPDEFLQEQMNKPPCRFYQQQGYCEFQLLCRYSHVTYDPYSAQPILPPELIQWFQSHERQTENKPKKTKRPRLPTGWKVKSLPLSLKPPPLSTDYDWHHVGIWG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.45
4 0.5
5 0.5
6 0.54
7 0.53
8 0.56
9 0.57
10 0.54
11 0.56
12 0.51
13 0.47
14 0.5
15 0.54
16 0.55
17 0.52
18 0.52
19 0.46
20 0.46
21 0.48
22 0.4
23 0.4
24 0.41
25 0.44
26 0.44
27 0.47
28 0.48
29 0.44
30 0.44
31 0.37
32 0.35
33 0.29
34 0.25
35 0.25
36 0.22
37 0.24
38 0.3
39 0.36
40 0.33
41 0.32
42 0.35
43 0.3
44 0.35
45 0.37
46 0.34
47 0.37
48 0.42
49 0.46
50 0.45
51 0.47
52 0.4
53 0.39
54 0.35
55 0.24
56 0.24
57 0.2
58 0.17
59 0.15
60 0.17
61 0.15
62 0.16
63 0.17
64 0.14
65 0.13
66 0.16
67 0.16
68 0.14
69 0.15
70 0.14
71 0.12
72 0.12
73 0.13
74 0.12
75 0.11
76 0.1
77 0.1
78 0.13
79 0.14
80 0.13
81 0.12
82 0.13
83 0.16
84 0.21
85 0.22
86 0.2
87 0.25
88 0.28
89 0.35
90 0.43
91 0.49
92 0.54
93 0.61
94 0.68
95 0.74
96 0.82
97 0.85
98 0.85
99 0.86
100 0.87
101 0.88
102 0.91
103 0.9
104 0.9
105 0.85
106 0.8
107 0.71
108 0.67
109 0.63
110 0.56
111 0.53
112 0.49
113 0.49
114 0.49
115 0.55
116 0.52
117 0.47
118 0.45
119 0.43
120 0.41
121 0.38
122 0.41
123 0.38
124 0.41
125 0.4
126 0.38