Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7N0R7

Protein Details
Accession A0A1C7N0R7    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-37TAAHKKLKVKKEVRLRRENQBasic
NLS Segment(s)
PositionSequence
22-34KKLKVKKEVRLRR
Subcellular Location(s) mito 17, nucl 10
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNHKLRKLRPSDVAVNLTAAHKKLKVKKEVRLRRENQGGLKKANQIEIWLLSIIFYFGIYRFIQDSFGAILLYQFPFIYILASENNRFPFLEYITQAYVHKKVVQHTTLKRIDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.38
4 0.33
5 0.28
6 0.22
7 0.19
8 0.19
9 0.27
10 0.34
11 0.42
12 0.5
13 0.55
14 0.62
15 0.71
16 0.77
17 0.79
18 0.81
19 0.76
20 0.75
21 0.76
22 0.71
23 0.68
24 0.66
25 0.61
26 0.53
27 0.52
28 0.48
29 0.42
30 0.4
31 0.32
32 0.24
33 0.22
34 0.19
35 0.17
36 0.12
37 0.1
38 0.07
39 0.07
40 0.06
41 0.05
42 0.04
43 0.03
44 0.03
45 0.06
46 0.06
47 0.07
48 0.08
49 0.08
50 0.09
51 0.09
52 0.1
53 0.07
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.07
60 0.06
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.05
67 0.06
68 0.09
69 0.11
70 0.13
71 0.15
72 0.17
73 0.17
74 0.17
75 0.18
76 0.18
77 0.19
78 0.22
79 0.2
80 0.22
81 0.22
82 0.24
83 0.23
84 0.25
85 0.24
86 0.22
87 0.25
88 0.25
89 0.29
90 0.36
91 0.4
92 0.46
93 0.5
94 0.57