Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C7MVE7

Protein Details
Accession A0A1C7MVE7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-60KAQVKQKRSYNKGKRTKHDYKAGBasic
NLS Segment(s)
PositionSequence
50-51GK
Subcellular Location(s) mito 11, nucl 9, cyto 4, pero 2
Family & Domain DBs
Amino Acid Sequences TKCAQITTPAQYETEPWAAYLKNHLPLIHGKPIANIEKAQVKQKRSYNKGKRTKHDYKAGDLIARRNLLKTGFPKEPWTGPWRILERNNEDGSSFKIVKLDDKHQHTTTANIKHMRPWNEENQRNHLISFKRGMM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.21
3 0.18
4 0.19
5 0.19
6 0.19
7 0.25
8 0.24
9 0.26
10 0.27
11 0.27
12 0.27
13 0.33
14 0.38
15 0.38
16 0.36
17 0.31
18 0.31
19 0.36
20 0.37
21 0.32
22 0.27
23 0.22
24 0.27
25 0.29
26 0.36
27 0.36
28 0.36
29 0.41
30 0.47
31 0.55
32 0.55
33 0.65
34 0.67
35 0.72
36 0.79
37 0.8
38 0.82
39 0.82
40 0.84
41 0.8
42 0.79
43 0.71
44 0.64
45 0.61
46 0.54
47 0.46
48 0.38
49 0.33
50 0.27
51 0.26
52 0.22
53 0.17
54 0.17
55 0.15
56 0.18
57 0.18
58 0.2
59 0.22
60 0.22
61 0.26
62 0.26
63 0.27
64 0.26
65 0.27
66 0.24
67 0.23
68 0.28
69 0.28
70 0.3
71 0.34
72 0.37
73 0.38
74 0.43
75 0.42
76 0.36
77 0.33
78 0.3
79 0.28
80 0.27
81 0.21
82 0.16
83 0.17
84 0.17
85 0.23
86 0.27
87 0.33
88 0.35
89 0.42
90 0.47
91 0.46
92 0.5
93 0.45
94 0.46
95 0.46
96 0.45
97 0.45
98 0.43
99 0.43
100 0.46
101 0.54
102 0.53
103 0.52
104 0.51
105 0.56
106 0.62
107 0.69
108 0.66
109 0.67
110 0.67
111 0.61
112 0.56
113 0.52
114 0.45
115 0.42