Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C7NGY8

Protein Details
Accession A0A1C7NGY8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
85-108EVLRAKNKALRERRANKKAEKTEAHydrophilic
NLS Segment(s)
PositionSequence
67-81IHKAKAEKVRAKTLA
84-105AEVLRAKNKALRERRANKKAEK
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR035970  60S_ribosomal_L19/L19e_sf  
IPR000196  Ribosomal_L19/L19e  
IPR039547  RPL19  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01280  Ribosomal_L19e  
Amino Acid Sequences MGYGKRKGTADARMRTQVIWMRRMRVLRRLLAKYREAGKIDKHLYHSLYLKSKGNGFKNKRVLMEHIHKAKAEKVRAKTLAEQAEVLRAKNKALRERRANKKAEKTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.49
4 0.45
5 0.4
6 0.42
7 0.39
8 0.38
9 0.41
10 0.48
11 0.46
12 0.48
13 0.49
14 0.47
15 0.52
16 0.55
17 0.57
18 0.56
19 0.54
20 0.51
21 0.5
22 0.48
23 0.42
24 0.38
25 0.34
26 0.36
27 0.37
28 0.35
29 0.34
30 0.32
31 0.31
32 0.31
33 0.31
34 0.27
35 0.28
36 0.28
37 0.26
38 0.24
39 0.28
40 0.31
41 0.35
42 0.41
43 0.42
44 0.48
45 0.54
46 0.55
47 0.53
48 0.49
49 0.45
50 0.43
51 0.45
52 0.44
53 0.41
54 0.39
55 0.38
56 0.37
57 0.39
58 0.39
59 0.39
60 0.39
61 0.39
62 0.46
63 0.49
64 0.5
65 0.5
66 0.5
67 0.46
68 0.4
69 0.37
70 0.29
71 0.33
72 0.31
73 0.27
74 0.24
75 0.2
76 0.22
77 0.24
78 0.31
79 0.34
80 0.42
81 0.51
82 0.59
83 0.69
84 0.77
85 0.83
86 0.85
87 0.84
88 0.86